Protein detail
ANO9
Anoctamin-9 (Transmembrane protein 16J) (Tumor protein p53-inducible protein 5) (p53-induced gene 5 protein)
Entry name ANO9 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 8 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Anoctamin-9 (Transmembrane protein 16J) (Tumor protein p53-inducible protein 5) (p53-induced gene 5 protein)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
199..219; Helical; 265..285; Helical; 332..352; Helical; 374..394; Helical; 424..444; Helical; 553..573; Helical; 605..625; Helical; 704..724; Helical
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
PIG5TMEM16JTP53I5
Gene Description
Anoctamin 9
Chromosome
11
Position
417933-442011
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization5
Cell SpecificOligodendrocyte progenitor cellsSingle-Nuclei Brain Specificoligodendrocyte precursor cellBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway8
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (8)
- GO:0005229 intracellularly calcium-gated chloride channel activity
- GO:0005254 chloride channel activity
- GO:0005262 calcium channel activity
- GO:0005515 protein binding
- GO:0015267 channel activity
- GO:0017128 phospholipid scramblase activity
- GO:0019869 chloride channel inhibitor activity
- GO:0046983 protein dimerization activity
Biological Process (3)
Reactome (9)
- R-hsa-9733458 induction of cell cell fusion
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-9772573 late sars cov 2 infection events
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-2672351 stimuli sensing channels
- R-hsa-382551 transport of small molecules
- R-hsa-9824446 viral infection pathways
Canonical Pathways
M83 Pid cdc42 reg pathway
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence18
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| tmem16_phospholipid_scramblase | transporter | OmniPath | No | Yes | No | Yes | No |
| transporter | transporter | OmniPath | No | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western BlottingMass SpectrometryImmunoelectron MicroscopyFlow Cytometry | 1 | 36146834 |
Sequence, Structure & Domains8
Sequences
Length
782
Mass
90,333
Sequence
MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYVWDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHVLVVYRVLASALFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRFTIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDEFMEMMIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQVLETIGVLAVIANGMVIAFTSEFIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLAIRLAFVILFEHVALCIKLIAAWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPTPASIFSARSTDV
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=A1A5B4-1; Sequence=Displayed; Name=2; IsoId=A1A5B4-2; Sequence=VSP_036489, VSP_036492; Name=3; IsoId=A1A5B4-3; Sequence=VSP_036490, VSP_036491
Alternative Sequence
1..299; Missing (in isoform 2); 156..186; GEGRLKKTWARWRHMFREQPVDEIRNYFGEK -> VRGGPAWRGPWGGTLGWGLSLSVTRARGRDA (in isoform 3); 187..782; Missing (in isoform 3); 300..305; VWDEEQ -> MPAVSE (in isoform 2)
Domain & Motif Annotations
Region
756..782; Disordered
Protein Families
Anoctamin family
Sequence Similarities
Belongs to the anoctamin family.
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |