Protein detail
RB27B
Ras-related protein Rab-27B (EC 3.6.5.2) (C25KG)
Entry name RB27B | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Ras-related protein Rab-27B (EC 3.6.5.2) (C25KG)
Protein Class (3)
EnzymesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Description
RAB27B, member RAS oncogene family
Chromosome
18
Position
54717860-54895516
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component (15)
- GO:0005770 late endosome
- GO:0005794 Golgi apparatus
- GO:0005795 Golgi stack
- GO:0005886 plasma membrane
- GO:0016324 apical plasma membrane
- GO:0030140 trans-Golgi network transport vesicle
- GO:0030141 secretory granule
- GO:0030672 synaptic vesicle membrane
- GO:0031088 platelet dense granule membrane
- GO:0032585 multivesicular body membrane
Page 1 of 2
Molecular Function (7)
Biological Process (3)
Reactome (9)
- R-hsa-109582 hemostasis
- R-hsa-199991 membrane trafficking
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-597592 post translational protein modification
- R-hsa-8876198 rab gefs exchange gtp for gdp on rabs
- R-hsa-8873719 rab geranylgeranylation
- R-hsa-9007101 rab regulation of trafficking
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5653656 vesicle mediated transport
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence7
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass SpectrometryElisa | 1 | 38071653 |
Sequence, Structure & Domains
Sequences
Length
218
Mass
24,608
Sequence
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
3D Structural Models
Turn
122..124; 164..166
Helix
22..30; 78..89; 104..115; 138..140; 145..154; 170..188
Beta Strand
7..16; 37..54; 65..77; 94..100; 127..133; 159..162
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
207..218; Basic and acidic residues
Domain (CC)
Switch I, switch II and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drive interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.
Region
36..44; Switch-I; 77..93; Switch-II; 194..218; Disordered
Protein Families (2)
- Small GTPase superfamily
- Rab family
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No related sentences available |