Protein detail

CCRL2

C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)

Entry name CCRL2	UniProt ID O00421	EVMP confidence score 0.50
Supporting publications (n) 4	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)

Protein Class (2)

G-protein coupled receptorsPredicted membrane proteins

Protein Function (2)

G-protein coupled receptors:Chemokines and chemotactic factors receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

44..64; Helical; Name=1; 75..95; Helical; Name=2; 105..125; Helical; Name=3; 145..165; Helical; Name=4; 199..219; Helical; Name=5; 239..259; Helical; Name=6; 287..307; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000121797

Entrez Gene Symbol

CCRL2

Gene Synonym (5)

ACKR5CKRXCRAM-ACRAM-BHCR

Gene Description

C-C motif chemokine receptor like 2

Chromosome

Position

46407166-46412997

Supporting publications (n)

EVMP confidence score

0.50

Function & Pathway6

Protein Function (2)

G-protein coupled receptors:Chemokines and chemotactic factors receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (3)

Molecular Function (6)

Biological Process (3)

Reactome (5)

Mediation Categories (3)

Fusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence61

Ligand-Receptor Signaling (60)

60 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	Guide2Pharma	No	Yes	No	Yes	No
gpcr	receptor	DGIdb	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No

Page 1 of 6Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Western blotting	2	38731868 40098346

Sequence, Structure & Domains10

Sequences

Length

344

Mass

39,513

Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=CRAM-B; IsoId=O00421-1; Sequence=Displayed; Name=2; Synonyms=CRAM-A; IsoId=O00421-2; Sequence=VSP_018584

Alternative Sequence

1; M -> MIYTRFLKGSLKM (in isoform 2)

Domain & Motif Annotations

Compositional Bias

324..333; Polar residues; 334..344; Basic and acidic residues

Domain (CC)

Lacks the conserved DRYLAIV motif in the second intracellular loop that is required for signaling of functional chemokine receptors.

Region

324..344; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance1

Antibody

HPA043238

Supporting Publications4

PMID	Title	Abstract
36512648	Exosomal miR-655-3p inhibits growth, and invasion and macrophage M2 polarization through targeting CXCR4 in papillary thyroid carcinoma.	In Xenograft tumor experiment, upregulated exosome-miR-655-3p effectively inhibited the growth of tumor and reduced the expression of CXCR4, Ki67 and CD163 in vivo.
37452413	Tumor-derived small extracellular vesicles promote breast cancer progression by upregulating PD-L1 expression in macrophages.	No abstract available
37475710	Monocyte phenotype and extracellular vesicles in HIV-1, HIV-2, and HIV-1/2 dual infection.	Peripheral blood mononuclear cells (PBMCs) were isolated and analyzed by flow cytometry for monocyte phenotype and activation, and plasma was analyzed for extracellular vesicle forms of CD163 and CD206.
37993261	Hypoxia-regulated exosomes mediate M2 macrophage polarization and promote metastasis in chondrosarcoma.	These hypoxia-induced exosomes promoted macrophage polarization towards the M2 phenotype, characterized by the expression of CD163 and CD206, but not the M1 phenotype, characterized by CD86 expression.