Protein detail
CCRL2
C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)
Entry name CCRL2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)
Protein Class (2)
G-protein coupled receptorsPredicted membrane proteins
Protein Function (2)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
44..64; Helical; Name=1; 75..95; Helical; Name=2; 105..125; Helical; Name=3; 145..165; Helical; Name=4; 199..219; Helical; Name=5; 239..259; Helical; Name=6; 287..307; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
ACKR5CKRXCRAM-ACRAM-BHCR
Gene Description
C-C motif chemokine receptor like 2
Chromosome
3
Position
46407166-46412997
Supporting publications (n)
4
EVMP confidence score
0.53
Function & Pathway
Protein Function (2)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (3)
Molecular Function (6)
Biological Process (3)
Reactome (5)
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence61
Ligand-Receptor Signaling (60)
60 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | talklr | Yes | Yes | |||
| receptor | receptor | Cellinker | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes |
Sequence, Structure & Domains
Sequences
Length
344
Mass
39,513
Sequence
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=CRAM-B; IsoId=O00421-1; Sequence=Displayed; Name=2; Synonyms=CRAM-A; IsoId=O00421-2; Sequence=VSP_018584
Alternative Sequence
1; M -> MIYTRFLKGSLKM (in isoform 2)
Domain & Motif Annotations
Compositional Bias
324..333; Polar residues; 334..344; Basic and acidic residues
Domain (CC)
Lacks the conserved DRYLAIV motif in the second intracellular loop that is required for signaling of functional chemokine receptors.
Region
324..344; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Antibody
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 36512648 | Exosomal miR-655-3p inhibits growth, and invasion and macrophage M2 polarization through targeting CXCR4 in papillary thyroid carcinoma. | In Xenograft tumor experiment, upregulated exosome-miR-655-3p effectively inhibited the growth of tumor and reduced the expression of CXCR4, Ki67 and CD163 in vivo. |
| 37452413 | Tumor-derived small extracellular vesicles promote breast cancer progression by upregulating PD-L1 expression in macrophages. | Tumor-derived small extracellular vesicles promote breast cancer progression by upregulating PD-L1 expression in macrophages. |
| 37475710 | Monocyte phenotype and extracellular vesicles in HIV-1, HIV-2, and HIV-1/2 dual infection. | Peripheral blood mononuclear cells (PBMCs) were isolated and analyzed by flow cytometry for monocyte phenotype and activation, and plasma was analyzed for extracellular vesicle forms of CD163 and CD206. |
| 37993261 | Hypoxia-regulated exosomes mediate M2 macrophage polarization and promote metastasis in chondrosarcoma. | These hypoxia-induced exosomes promoted macrophage polarization towards the M2 phenotype, characterized by the expression of CD163 and CD206, but not the M1 phenotype, characterized by CD86 expression. |