Protein detail
GFRA2
GDNF family receptor alpha-2 (GDNF receptor alpha-2) (GDNFR-alpha-2) (GFR-alpha-2) (GDNF receptor beta) (GDNFR-beta) (Neurturin receptor alpha) (NRTNR-alpha) (NTNR-alpha) (RET ligand 2) (TGF-beta-related neurotrophic factor receptor 2)
Entry name GFRA2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
GDNF family receptor alpha-2 (GDNF receptor alpha-2) (GDNFR-alpha-2) (GFR-alpha-2) (GDNF receptor beta) (GDNFR-beta) (Neurturin receptor alpha) (NRTNR-alpha) (NTNR-alpha) (RET ligand 2) (TGF-beta-related neurotrophic factor receptor 2)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
GDNFRBNTNRARETL2TRNR2
Gene Description
GDNF family receptor alpha 2
Chromosome
8
Position
21690398-21812357
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificB-cellsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Reactome (6)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence43
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | talklr | Yes | Yes | |||
| receptor | receptor | Cellinker | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | connectomeDB2020 | Yes | Yes | |||
| receptor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| receptor | receptor | EMBRACE | Yes | Yes |
Page 4 of 4Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GDNF | P39905 | GFRA2 | O00451 | Yes | Yes | iTALKSIGNORHINTHPMR_talklrHPRD_LRdbtalklrHPRDRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbReactome_LRdbHPRD_talklrBaccin2019CellinkerSTRING_talklrFantom5_LRdbCellTalkDBHPMR_CellinkerconnectomeDB2020LRdb | HINT:9407096LRdb:941LRdb:9182803Cellinker:9407096connectomeDB2020:9182803Cellinker:9182803HINT:10829012SIGNOR:9192898CellTalkDB:9182803connectomeDB2020:9407096HPRD:9407096Baccin2019:91828039407096 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
464
Mass
51,544
Sequence
MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long; IsoId=O00451-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O00451-2; Sequence=VSP_001661; Name=3; IsoId=O00451-3; Sequence=VSP_046112
Alternative Sequence
14..146; Missing (in isoform 2); 14..118; Missing (in isoform 3)
3D Structural Models
Turn
89..92; 299..302
Helix
40..48; 51..64; 76..86; 102..111; 160..169; 172..186; 197..210; 213..220; 227..235; 239..242; 251..260; 262..275; 286..288; 290..298; 329..331; 332..343; 346..355
Beta Strand
193..195; 279..281; 307..309; 314..316; 319..322
3D Structure
Electron microscopy (3); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
381..392; Low complexity
Region
363..392; Disordered
Protein Families
GDNFR family
Sequence Similarities
Belongs to the GDNFR family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |