Protein detail

AGRIN

Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]

Entry name
AGRIN
UniProt ID
EVMP confidence score
0.75
Supporting publications (n)
36
Transmembrane count
Protein classification
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information11
Protein Names
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Protein Class (7)
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
Protein Function (6)
  • Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
  • Predicted intracellular proteins
  • Potential drug targets
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Entrez Gene Symbol
Gene Synonym
AGRIN
Gene Description
Agrin
Chromosome
1
Position
1020120-1056118
Supporting publications (n)
36
EVMP confidence score
0.75
Function & Pathway8
Protein Function (6)
  • Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
  • Predicted intracellular proteins
  • Potential drug targets
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Canonical Pathways (3)
  • M3468 Naba ecm regulators
  • M5885 Naba matrisome associated
  • M5889 Naba matrisome
Mediation Categories (4)
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence31

Ligand-Receptor Signaling (26)

26 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
ecmecmGO_IntercellYesNoYesNoNo
ecmecmRamilowski_locationYesNoYesNoNo
ecmecmUniProt_locationYesNoYesNoNo
proteoglycanecmOmniPathYesNoYesNoNo
ecmecmOmniPathYesNoYesNoNo
extracellularextracellularHPMRNoNoYesNoNo
extracellularextracellularLOCATENoNoYesNoNo
extracellularextracellularOmniPathNoNoYesNoNo
intracellularintracellularComPPINoNoYesNoNo
intracellularintracellularGO_IntercellNoNoYesNoNo
Page 1 of 3Next

Regulatory Interaction Network (3)

3 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
AGRINO00468MUSKO15146YesYesNoHPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015Reactome_LRdbconnectomeDB2020HINTSignaLink3CellinkerLRdbHPMR_talklrSignaLink3:18848351HPMR:8653787connectomeDB2020:8653787Cellinker:8653787LRdb:8653787HINT:37252960SignaLink3:23331499CellTalkDB:8653787
AGRINO00468LRP4O75096YesYesNoFantom5_LRdbCellTalkDBiTALKtalklrSIGNORReactome_LRdbconnectomeDB2020HINTCellinkerLRdbRamilowski2015SIGNOR:23458718Cellinker:18848351LRdb:18848351HINT:37252960Ramilowski2015:18848351talklr:18848351connectomeDB2020:18848351
AGRINO00468ACHB3Q05901YesYesNoSIGNORSIGNOR:14502292

Protein Complex Composition (1)

1 record.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
AGRNAPPCOPG1FOSO00468P01100P05067Q9Y6781:1:1:1NetworkBlastCompleatCompleat:HC4016

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity CaptureMass spectrometryWestern blottingFlow cytometry437862381392904593055028740098346
Sequence, Structure & Domains10

Sequences

Length
2,068
Mass
217,320
Sequence
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGATSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Many isoforms may exist depending on the occurrence and length of inserts at the x, y or z splice site. Four 'z' isoforms can be produced with inserts of 0, 8, 11 or 19 AA. Isoform 3 and isoform 6 lack any 'z' insert. Isoforms differ in their acetylcholine receptor clustering activity and tissue specificity.; Name=1; Synonyms=Secreted agrin, LN-agrin; IsoId=O00468-1; Sequence=Displayed; Name=2; Synonyms=Transmembrane agrin, TM-agrin; IsoId=O00468-2; Sequence=VSP_045753, VSP_045754; Name=3; Synonyms=Agrin z(0); IsoId=O00468-3; Sequence=VSP_045756; Name=4; Synonyms=Agrin z(+11); IsoId=O00468-4; Sequence=VSP_045757; Name=5; Synonyms=Agrin z(+8); IsoId=O00468-5; Sequence=VSP_045758; Name=6; Synonyms=Agrin y(0)z(0); IsoId=O00468-6; Sequence=VSP_045755, VSP_045756; Name=7; Synonyms=y(0); IsoId=O00468-7; Sequence=VSP_045755
Alternative Sequence
1..104; Missing (in isoform 2); 105..154; NQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVE -> MPXLAVARDTRQPAGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNY (in isoform 2); 1752..1755; Missing (in isoform 6 and isoform 7); 1889..1907; Missing (in isoform 3 and isoform 6); 1889..1896; Missing (in isoform 4); 1897..1907; Missing (in isoform 5)

3D Structural Models

3D Structure
Electron microscopy (1)

Domain & Motif Annotations

Compositional Bias
1023..1042; Low complexity; 1050..1065; Low complexity; 1297..1318; Low complexity; 1321..1332; Pro residues
Domain (CC)
The NtA domain, absent in TM-agrin, is required for binding laminin and connecting to basal lamina.; DOMAIN: Both laminin G-like 2 (G2) and laminin G-like 3 (G3) domains are required for alpha-dystroglycan/DAG1 binding. G3 domain is required for C-terminal heparin, heparan sulfate and sialic acid binding (By similarity).
Domain (FT)
31..157; NtA; 191..244; Kazal-like 1; 264..319; Kazal-like 2; 337..391; Kazal-like 3; 408..463; Kazal-like 4; 484..536; Kazal-like 5; 540..601; Kazal-like 6; 607..666; Kazal-like 7; 699..752; Kazal-like 8; 793..846; Laminin EGF-like 1; 847..893; Laminin EGF-like 2; 917..971; Kazal-like 9; 1130..1252; SEA; 1329..1367; EGF-like 1; 1372..1548; Laminin G-like 1; 1549..1586; EGF-like 2; 1588..1625; EGF-like 3; 1635..1822; Laminin G-like 2; 1818..1857; EGF-like 4; 1868..2065; Laminin G-like 3
Region
995..1096; Disordered; 1277..1334; Disordered
Clinical Relevance2
Disease Involvement (2)
Congenital myasthenic syndromeDisease variant
Antibody
Supporting Publications32
PMIDTitleAbstract
36982312Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis.No abstract available
37205098Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers.No abstract available
37438638Extracellular Vesicles Play a Central Role in Cerebral Venous Disease-Associated Brain Atrophy.No abstract available
37786918Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.No abstract available
38014595Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.No abstract available
38168906Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis.No abstract available
38321535Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.No abstract available
39505756Differential proteomic profiles of exosomes in pediatric and adult adamantinomatous craniopharyngioma cyst fluid.No abstract available
39940641Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients.No abstract available
40089067Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells.No abstract available
Page 3 of 4PreviousNext