Protein detail
F16P2
Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)
Entry name F16P2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Disease related genesEnzymesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)
Protein Class (6)
Disease related genesEnzymesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
Fructose-bisphosphatase 2
Chromosome
9
Position
94558720-94593824
Supporting publications (n)
4
EVMP confidence score
0.38
Fluorescence & Localization3
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway8
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component (7)
Molecular Function (4)
Biological Process (3)
KEGG (8)
Reactome (3)
Canonical Pathways
M177 Pid epha fwdpathway
Mediation Categories
Metabolism mediation
Relations & Evidence12
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IGF2-IGFBP2 complex | IGF2IGFBP2 | P01344P18065 | 0:0 | CORUM | CORUM:6191 | 24604839 |
| FBP2 | O00757 | 4 | PDB | PDB:3ifcPDB:5q0cPDB:5et7PDB:3ifaPDB:5et6 | ||
| FBP1FBP2HMGCS1IGBP1ST6GALNAC5TTR | O00757P02766P09467P78318Q01581Q9BVH7 | 0:0:0:0:0:0 | hu.MAP2 | |||
| FBP1FBP2 | O00757P09467 | 0:0 | hu.MAPhu.MAP2 | |||
| FBP1FBP2ST6GALNAC5 | O00757P09467Q9BVH7 | 0:0:0 | hu.MAPhu.MAP2 | |||
| BMPERCOL18A1CTSFDEFA1BIGFBP2TKFC | P18065P39060P59665Q3LXA3Q8N8U9Q9UBX1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| BMPERDEFA1BIGFBP2 | P18065P59665Q8N8U9 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains11
Sequences
Length
339
Mass
36,743
Sequence
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
3D Structural Models
Turn
51..54; 58..61; 88..90; 127..130; 189..192; 278..281
Helix
14..24; 30..50; 74..87; 108..110; 124..126; 150..153; 157..159; 214..219; 222..232; 249..259; 282..291; 303..305; 322..335
Beta Strand
70..72; 92..97; 111..122; 133..141; 145..147; 161..180; 182..188; 193..201; 208..211; 235..237; 262..265; 268..270; 275..277; 295..297; 299..302; 317..321
3D Structure
X-ray crystallography (14)
Domain & Motif Annotations
Motif
204..208; Nuclear localization signal
Region
3..10; Important for interaction with ALDOA
Protein Families
FBPase class 1 family
Sequence Similarities
Belongs to the FBPase class 1 family.
Clinical Relevance6
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |