Protein detail
CLD4
Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)
Entry name CLD4 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 17 | Transmembrane count 4 | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)
Protein Class (6)
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Transporter channels and pores
- Disease related genes
Transmembrane
8..28; Helical; 82..102; Helical; 118..138; Helical; 161..181; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CPE-RCPETRCPETR1hCPE-RWBSCR8
Gene Description
Claudin 4
Chromosome
7
Position
73799542-73832690
Supporting publications (n)
17
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificgallbladderCell SpecificEpicardial cellsSingle-Nuclei Brain Specificmammillary body
Function & Pathway
Protein Function (5)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Transporter channels and pores
- Disease related genes
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
KEGG (7)
Reactome (3)
Canonical Pathways (2)
- M257 Pid ephrinb rev pathway
- M62 Pid ephb fwd pathway
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence35
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CLDN4 | EPHA2 | P29317 | Y | 208 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | phosphoELM:16236711KEA:16236711 |
| CLDN4 | PRKCA | P17252 | S | 194 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CLDN4 | PRKCE | Q02156 | S | 194 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:17678893ProtMapper:18786529 |
| CLDN4 | PRKCE | Q02156 | T | 189 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:17678893ProtMapper:18786529 |
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| tight_junction | tight_junction | HGNC | Yes | Yes | |||
| claudin | tight_junction | Almen2009 | Yes | Yes | |||
| tight_junction | tight_junction | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | GO_Intercell | |||||
| transmembrane | transmembrane | OPM | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPHA2 | P29317 | CLD4 | O14493 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:16236711SIGNOR:16236711ProtMapper:16236711PhosphoSite:16236711ProtMapper:18036336phosphoELM:16236711KEA:16236711 | |
| KPCA | P17252 | CLD4 | O14493 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:18786529 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
209
Mass
22,077
Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
3D Structural Models
Helix
7..26; 75..100; 113..148; 162..182
Beta Strand
1..3; 30..35; 44..48; 50..56; 58..60; 63..66; 70..73; 101..105; 158..160
3D Structure
Electron microscopy (6); X-ray crystallography (2)
Domain & Motif Annotations
Region
1..103; Interaction with EPHA2; 208..209; Interactions with TJP1, TJP2 and TJP3
Protein Families
Claudin family
Sequence Similarities
Belongs to the claudin family.
Clinical Relevance
Disease Involvement (2)
Cancer-related genesWilliams-Beuren syndrome
Related Diseases
Antibody
Supporting Publications17
| PMID | Title | Related sentences |
|---|---|---|
| 19837982 | Proteomics analysis of A33 immunoaffinity-purified exosomes released from the human colon tumor cell line LIM1215 reveals a tissue-specific protein signature. | A conspicuous finding of this comparative analysis was the presence of host cell-specific (LIM1215 exosome) proteins such as A33, cadherin-17, carcinoembryonic antigen, epithelial cell surface antigen (EpCAM), proliferating cell nuclear antigen, epidermal growth factor receptor, mucin 13, misshapen-like kinase 1, keratin 18, mitogen-activated protein kinase 4, claudins (1, 3, and 7), centrosomal protein 55 kDa, and ephrin-B1 and -B2. Here, we describe an immunoaffinity capture method using the colon epithelial cell-specific A33 antibody to purify colorectal cancer cell (LIM1215)-derived exosomes. |
| 21630462 | Proteomic analysis of microvesicles derived from human colorectal cancer ascites. | No related sentences available |
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 34980157 | Proteomic analysis of extracellular vesicles secreted by primary human epithelial endometrial cells reveals key proteins related to embryo implantation. | No related sentences available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No related sentences available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No related sentences available |
Page 1 of 2Next