Protein detail
CLD4
Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)
Entry name CLD4 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 17 | Transmembrane count 4 | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)
Protein Class (6)
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Transporter channels and pores
- Disease related genes
Transmembrane
8..28; Helical; 82..102; Helical; 118..138; Helical; 161..181; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CPE-RCPETRCPETR1hCPE-RWBSCR8
Gene Description
Claudin 4
Chromosome
7
Position
73799542-73832690
Supporting publications (n)
17
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificgallbladderCell SpecificEpicardial cellsSingle-Nuclei Brain Specificmammillary body
Function & Pathway
Protein Function (5)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Transporter channels and pores
- Disease related genes
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
KEGG (7)
Reactome (3)
Canonical Pathways (2)
- M257 Pid ephrinb rev pathway
- M62 Pid ephb fwd pathway
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence35
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CLDN4 | EPHA2 | P29317 | Y | 208 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | phosphoELM:16236711KEA:16236711 |
| CLDN4 | PRKCA | P17252 | S | 194 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CLDN4 | PRKCE | Q02156 | S | 194 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:17678893ProtMapper:18786529 |
| CLDN4 | PRKCE | Q02156 | T | 189 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:17678893ProtMapper:18786529 |
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | OmniPath | |||||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | |||
| adhesion | adhesion | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | |||
| ion_channel | ion_channel | DGIdb | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| ion_channel | ion_channel | OmniPath | Yes | ||||
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | |||
| tight_junction | tight_junction | Zhong2015 | Yes | Yes |
Page 1 of 3Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPHA2 | P29317 | CLD4 | O14493 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:16236711SIGNOR:16236711ProtMapper:16236711PhosphoSite:16236711ProtMapper:18036336phosphoELM:16236711KEA:16236711 | |
| KPCA | P17252 | CLD4 | O14493 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:18786529 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
209
Mass
22,077
Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
3D Structural Models
Helix
7..26; 75..100; 113..148; 162..182
Beta Strand
1..3; 30..35; 44..48; 50..56; 58..60; 63..66; 70..73; 101..105; 158..160
3D Structure
Electron microscopy (6); X-ray crystallography (2)
Domain & Motif Annotations
Region
1..103; Interaction with EPHA2; 208..209; Interactions with TJP1, TJP2 and TJP3
Protein Families
Claudin family
Sequence Similarities
Belongs to the claudin family.
Clinical Relevance
Disease Involvement (2)
Cancer-related genesWilliams-Beuren syndrome
Related Diseases
Antibody
Supporting Publications17
| PMID | Title | Related sentences |
|---|---|---|
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |
| 39569406 | Proteomics of circulating extracellular vesicles reveals diverse clinical presentations of COVID-19 but fails to identify viral peptides. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 40089067 | Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells. | No related sentences available |
Page 2 of 2Previous