Protein detail

RHG33

Rho GTPase-activating protein 33 (Rho-type GTPase-activating protein 33) (Sorting nexin-26) (Tc10/CDC42 GTPase-activating protein)

Entry name RHG33	UniProt ID O14559	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Rho GTPase-activating protein 33 (Rho-type GTPase-activating protein 33) (Sorting nexin-26) (Tc10/CDC42 GTPase-activating protein)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000004777

Entrez Gene Symbol

ARHGAP33

Gene Synonym (3)

FLJ39019SNX26TCGAP

Gene Description

Rho GTPase activating protein 33

Chromosome

Position

35774532-35788822

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificEnterocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (11)

Page 1 of 2

Molecular Function (4)

Biological Process (3)

Reactome (5)

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence7

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ARHGAP33	FYN	P06241	Y	406	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:16777849 KEA:16777849 SIGNOR:16777849 HPRD:16777849

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
RHG33	O14559	RAC1	P63000	Yes	No	Yes	SPIKESPIKE_LCSIGNOR	SPIKE:20936779 SPIKE_LC:20936779 SIGNOR:32203420
FYN	P06241	RHG33	O14559	Yes	No	Yes	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSiteKEAHPRD_KEASIGNOR_ProtMapperLit-BM-17HPRD-phosPhosphoSite_ProtMapper	Lit-BM-17:16777849 HPRD:16777849 SIGNOR:16777849 PhosphoSite:16777849 HPRD-phos:16777849 ProtMapper:16777849 KEA:16777849

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass Spectrometry	1	38037300

Sequence, Structure & Domains10

Sequences

Length

1,287

Mass

137,213

Sequence

MVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFGHIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELESVGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPSTRLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWKTFFALGRGPSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHSSSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHRTSAWLDDGDELDFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGRSLRPHLIPLLLRGAEAPLTDACQQEMCSKLRGAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPKNPARLMALALAERAQQVAEQQSQQECGGTPPASQSPFHRSLSLEVGGEPLGTSGSGPPPNSLAHPGAWVPGPPPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWRSSLGPPAPLDRGENLYYEIGASEGSPYSGPTRSWSPFRSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPPAPSCFPPDHLGYSAPQHPARRPTPPEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPWGPRTPHRVPGPWGPPEPLLLYRAAPPAYGRGGELHRGSLYRNGGQRGEGAGPPPPYPTPSWSLHSEGQTRSYC

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O14559-1; Sequence=Displayed; Name=2; IsoId=O14559-10; Sequence=VSP_014287, VSP_014292; Name=3; IsoId=O14559-11; Sequence=VSP_014291; Name=4; IsoId=O14559-12; Sequence=VSP_014288, VSP_014289, VSP_014290

Alternative Sequence

1..136; Missing (in isoform 2); 1..2; MV -> MLSLSLCSHLWGPLILSALQ (in isoform 4); 168..228; LDNHGRRLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWR -> VGLGRGLGDSEWVRGCVCHHAQHREILDGNRVASAVEDEGAEVDGEAFRWGSLWVGESWDM (in isoform 4); 229..1287; Missing (in isoform 4); 648..808; Missing (in isoform 3); 998..1025; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

558..571; Low complexity; 572..584; Basic and acidic residues; 622..645; Polar residues; 672..709; Low complexity; 752..766; Pro residues; 813..829; Low complexity; 896..919; Low complexity; 972..981; Polar residues; 1019..1028; Polar residues; 1175..1189; Low complexity; 1274..1287; Polar residues

Domain (FT)

59..168; PX; atypical; 186..248; SH3; 315..510; Rho-GAP

Region

1..40; Disordered; 551..792; Disordered; 813..832; Disordered; 859..1030; Disordered; 1056..1075; Disordered; 1090..1134; Disordered; 1146..1287; Disordered

Protein Families

PX domain-containing GAP family

Sequence Similarities

Belongs to the PX domain-containing GAP family.

Clinical Relevance1

Antibody (2)

HPA030117 HPA030118

Supporting Publications1

PMID	Title	Abstract
30301952	A position on vision.	No abstract available