Protein detail
RHG33
Rho GTPase-activating protein 33 (Rho-type GTPase-activating protein 33) (Sorting nexin-26) (Tc10/CDC42 GTPase-activating protein)
Protein symbol RHG33 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Rho GTPase-activating protein 33 (Rho-type GTPase-activating protein 33) (Sorting nexin-26) (Tc10/CDC42 GTPase-activating protein)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ39019SNX26TCGAP
Gene Description
Rho GTPase activating protein 33
Chromosome
19
Position
35774532-35788822
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificEnterocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ARHGAP33 | FYN | P06241 | Y | 406 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16777849KEA:16777849SIGNOR:16777849HPRD:16777849 |
Ligand-Receptor Signaling
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RHG33 | O14559 | RAC1 | P63000 | Yes | No | Yes | SPIKESPIKE_LCSIGNOR | SPIKE:20936779SPIKE_LC:20936779SIGNOR:32203420 |
| FYN | P06241 | RHG33 | O14559 | Yes | No | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSiteKEAHPRD_KEASIGNOR_ProtMapperLit-BM-17HPRD-phosPhosphoSite_ProtMapper | Lit-BM-17:16777849HPRD:16777849SIGNOR:16777849PhosphoSite:16777849HPRD-phos:16777849ProtMapper:16777849KEA:16777849 |
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
1,287
Mass
137,213
Sequence
MVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFGHIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELESVGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPSTRLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWKTFFALGRGPSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHSSSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHRTSAWLDDGDELDFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGRSLRPHLIPLLLRGAEAPLTDACQQEMCSKLRGAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPKNPARLMALALAERAQQVAEQQSQQECGGTPPASQSPFHRSLSLEVGGEPLGTSGSGPPPNSLAHPGAWVPGPPPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWRSSLGPPAPLDRGENLYYEIGASEGSPYSGPTRSWSPFRSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPPAPSCFPPDHLGYSAPQHPARRPTPPEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPWGPRTPHRVPGPWGPPEPLLLYRAAPPAYGRGGELHRGSLYRNGGQRGEGAGPPPPYPTPSWSLHSEGQTRSYC
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O14559-1; Sequence=Displayed; Name=2; IsoId=O14559-10; Sequence=VSP_014287, VSP_014292; Name=3; IsoId=O14559-11; Sequence=VSP_014291; Name=4; IsoId=O14559-12; Sequence=VSP_014288, VSP_014289, VSP_014290
Alternative Sequence
1..136; Missing (in isoform 2); 1..2; MV -> MLSLSLCSHLWGPLILSALQ (in isoform 4); 168..228; LDNHGRRLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWR -> VGLGRGLGDSEWVRGCVCHHAQHREILDGNRVASAVEDEGAEVDGEAFRWGSLWVGESWDM (in isoform 4); 229..1287; Missing (in isoform 4); 648..808; Missing (in isoform 3); 998..1025; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
558..571; Low complexity; 572..584; Basic and acidic residues; 622..645; Polar residues; 672..709; Low complexity; 752..766; Pro residues; 813..829; Low complexity; 896..919; Low complexity; 972..981; Polar residues; 1019..1028; Polar residues; 1175..1189; Low complexity; 1274..1287; Polar residues
Domain (FT)
59..168; PX; atypical; 186..248; SH3; 315..510; Rho-GAP
Region
1..40; Disordered; 551..792; Disordered; 813..832; Disordered; 859..1030; Disordered; 1056..1075; Disordered; 1090..1134; Disordered; 1146..1287; Disordered
Protein Families
PX domain-containing GAP family
Sequence Similarities
Belongs to the PX domain-containing GAP family.