Protein detail
LIN7A
Protein lin-7 homolog A (Lin-7A) (hLin-7) (Mammalian lin-seven protein 1) (MALS-1) (Tax interaction protein 33) (TIP-33) (Vertebrate lin-7 homolog 1) (Veli-1)
Entry name LIN7A | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Protein lin-7 homolog A (Lin-7A) (hLin-7) (Mammalian lin-seven protein 1) (MALS-1) (Tax interaction protein 33) (TIP-33) (Vertebrate lin-7 homolog 1) (Veli-1)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
LIN-7AMALS-1TIP-33VELI1
Gene Description
Lin-7 homolog A, crumbs cell polarity complex component
Chromosome
12
Position
80792520-80937934
EVMP confidence score
0.38
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (9)
Molecular Function (3)
Biological Process (3)
Reactome (9)
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-9609736 assembly and cell surface presentation of nmda receptors
- R-hsa-212676 dopamine neurotransmitter release cycle
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-112310 neurotransmitter release cycle
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-112315 transmission across chemical synapses
Mediation Categories
Fusion and delivery mediation
Relations & Evidence13
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | No | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LIN-10-LIN-2-LIN-7 complexLIN7A variant | APBA1CASKLIN7A | O14910O14936Q02410 | 1:1:1 | ComplexPortal | intact:EBI-42473541 | 158636171084615614755292 |
| LIN2-LIN7 complex | CASKLIN7A | O14910O14936 | 1:1 | CompleatCORUM | CORUM:3208Compleat:HC987 | 11865057 |
| VAM1-VELI1 complex | LIN7APALS2 | O14910Q9NZW5 | 1:1 | CompleatCORUM | CORUM:1089Compleat:HC3494 | 11311936 |
Isolation & Detection Technology (1)
1 record.
Sequence, Structure & Domains8
Sequences
Length
233
Mass
25,997
Sequence
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Domain & Motif Annotations
Motif
14..28; Kinase interacting site
Domain (CC)
The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.; DOMAIN: The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.; DOMAIN: The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.
Domain (FT)
25..80; L27; 108..190; PDZ
Protein Families
Lin-7 family
Sequence Similarities
Belongs to the lin-7 family.
Clinical Relevance4
Antibody
Interaction Protein (4)
ENSG00000072415ENSG00000105926ENSG00000147044ENSG00000150054
Interaction Count
4
Interaction Dataset
intact_biogrid