Protein detail

FYB1

FYN-binding protein 1 (Adhesion and degranulation promoting adaptor protein) (ADAP) (FYB-120/130) (p120/p130) (FYN-T-binding protein) (SLAP-130) (SLP-76-associated phosphoprotein)

Entry name FYB1	UniProt ID O15117	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

FYN-binding protein 1 (Adhesion and degranulation promoting adaptor protein) (ADAP) (FYB-120/130) (p120/p130) (FYN-T-binding protein) (SLAP-130) (SLP-76-associated phosphoprotein)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Human disease related genes:Cardiovascular diseases:Hematologic diseases
Predicted intracellular proteins

Ensembl

ENSG00000082074

Entrez Gene Symbol

FYB1

Gene Synonym (4)

ADAPFYBFYB-120/130SLAP-130

Gene Description

FYN binding protein 1

Chromosome

Position

39105252-39274528

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization4

Cell SpecificExtravillous trophoblastsSingle-Nuclei Brain SpecificleukocyteBlood Lineage Specificgranulocytes

Function & Pathway6

Protein Function (3)

Disease related genes
Human disease related genes:Cardiovascular diseases:Hematologic diseases
Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

KEGG (2)

Reactome (5)

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence33

Enzyme-Mediated Modification (26)

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
FYB1	SRC	P12931	Y	595	phosphorylation	Li2012
FYB1	SRC	P12931	Y	651	phosphorylation	Li2012
FYB1	SRC	P12931	Y	771	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:19632164
FYB1	ERBB2	P04626	Y	595	phosphorylation	KEA	KEA:17570479
FYB1	LCK	P06239	Y	595	phosphorylation	KEA	KEA:17570479
FYB1	LYN	P07948	Y	651	phosphorylation	KEA	KEA:17570479

Page 3 of 3Previous

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
FYN	P06241	FYB1	O15117	Yes	Yes	No	SPIKEHPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEALit-BM-17DOMINOPhosphoNetworksHPRDIntActWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteNetPathSPIKE_LCHPRD-phos	Lit-BM-17:17474147 DOMINO:9207119 PhosphoSite:24769494 phosphoELM:10409671 PhosphoSite:33431658 HINT:10409671 HPRD:7504057 IntAct:10409671 Lit-BM-17:10229084 Lit-BM-17:9748251 SPIKE_LC:9207119 KEA:10409671 Lit-BM-17:9207119 PhosphoSite:23979596 HPRD:10570256 HINT:7504057 Lit-BM-17:10409671 ProtMapper:10570256 NetPath:10497204 SPIKE:10497204 SPIKE:16713569 phosphoELM:10570256 KEA:10570256 Lit-BM-17:7504057 HINT:9207119 PhosphoSite:30305305 SIGNOR:10570256 IntAct:25814554 PhosphoSite:10570256 PhosphoSite:26246585 IntAct:9207119 SPIKE:9207119 HPRD:9207119 SPIKE_LC:16713569 IntAct:17474147 Lit-BM-17:25814554 SPIKE_LC:10497204 DOMINO:17474147 HPRD-phos:10570256 PhosphoSite:20661443

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
FYB-CARMA1-BCL-10-MALT1 complex	BCL10 CARD11 FYB1 MALT1	O15117 O95999 Q9BXL7 Q9UDY8	1:1:1:1	CompleatCORUM	CORUM:2753Compleat:HC506	17478723

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Western blotting	2	38731868 40098346

Sequence, Structure & Domains14

Sequences

Length

783

Mass

85,387

Sequence

MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQDHDLKPLGPKSGPTPPTSENEQKQAFPKLTGVKGKFMSASQDLEPKPLFPKPAFGQKPPLSTENSHEDESPMKNVSSSKGSPAPLGVRSKSGPLKPAREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGPPPPKPNRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLPPRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEKKRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAEQDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIYDND

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=FYB-120; IsoId=O15117-1; Sequence=Displayed; Name=FYB-130; IsoId=O15117-2; Sequence=VSP_042309; Name=3; IsoId=O15117-3; Sequence=VSP_047288, VSP_042309

Alternative Sequence

1; M -> MDGKADVKSLM (in isoform 3); 636; G -> GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS (in isoform FYB-130 and isoform 3)

3D Structural Models

Turn

751..753

Helix

498..504; 564..566; 572..575; 690..698; 760..762

Beta Strand

514..520; 526..528; 537..541; 546..548; 551..553; 559..562; 567..569; 736..750; 754..759

3D Structure

NMR spectroscopy (3)

Domain & Motif Annotations

Compositional Bias

1..18; Polar residues; 25..45; Polar residues; 69..79; Basic and acidic residues; 240..252; Basic and acidic residues; 278..290; Basic and acidic residues; 345..363; Pro residues; 374..387; Polar residues; 392..424; Pro residues; 451..465; Acidic residues; 466..501; Basic and acidic residues; 620..635; Acidic residues; 646..656; Acidic residues

Motif

462..465; SH2-binding; 469..505; Nuclear localization signal; 595..598; SH2-binding; to LCP2; 625..628; SH2-binding; to FYN; 674..700; Nuclear localization signal

Coiled Coil

456..507

Domain (FT)

511..572; SH3 1; 700..768; SH3 2

Region

1..502; Disordered; 348..448; Interaction with SKAP1; 598..678; Disordered

Clinical Relevance6

Disease Involvement

Disease variant

Drugs

COMPOUND 13 [PMID: 17502136]

Antibody (3)

CAB025336 HPA026796 HPA067427

Interaction Protein (3)

ENSG00000010810ENSG00000043462ENSG00000141293

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
27605433	Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo.	No abstract available