Protein detail
OBRG
Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)
Protein symbol OBRG | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count 4 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)
Protein Class
Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
7..27; Helical; 32..52; Helical; 69..89; Helical; 100..120; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
CD295OBR
Gene Description
Leptin receptor
Chromosome
1
Position
65420652-65641559
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component
Molecular Function
Biological Process
KEGG
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LEPR | JAK2 | O60674 | Y | 986 | phosphorylation | SIGNOR | SIGNOR:11018044 |
| LEPR | JAK2 | O60674 | Y | 1,141 | phosphorylation | SIGNORSparser_ProtMapperProtMapper | SIGNOR:11018044ProtMapper:11970889 |
| LEPR | GSK3B | P49841 | S | 100 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19923321 |
| LEPR | LEP | P41159 | Y | 1,079 | phosphorylation | Sparser_ProtMapperProtMapper |
Ligand-Receptor Signaling
72 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Baccin2019 | No | Yes | Yes | Yes | No |
| receptor | receptor | SignaLink_function | No | Yes | Yes | Yes | No |
| cytokine | receptor | Almen2009 | No | Yes | Yes | Yes | No |
| ig_like | receptor | Almen2009 | No | Yes | Yes | Yes | No |
| type1_ig_like_cytokine | receptor | Almen2009 | No | Yes | Yes | Yes | No |
| cytokine_receptor_il6_family | receptor | CellPhoneDB | No | Yes | Yes | Yes | No |
| growth_factor | receptor | Baccin2019 | No | Yes | Yes | Yes | No |
| cytokine_type_1 | receptor | HPMR | No | Yes | Yes | Yes | No |
| ghr_cytokine_type_1 | receptor | HPMR | No | Yes | Yes | Yes | No |
| ig | receptor | Surfaceome | No | Yes | Yes | Yes | No |
Regulatory Interaction Network
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LEPR | P48357 | PTN11 | Q06124 | Yes | Yes | No | NetPathSIGNORHPRDHINTLit-BM-17 | Lit-BM-17:9600917NetPath:10449753Lit-BM-17:11342028HINT:9600917SIGNOR:11085989HINT:11342028HPRD:11018044 |
Page 2 of 2Previous
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LEPR homodimer complex | LEPR | P48357 | 2 | CORUMPDB | CORUM:1992PDB:3v6o | 9038364 |
| SNX complex (SNX1SNX1aSNX2SNX4LEPR) | LEPRSNX1SNX2SNX4 | O60749O95219P48357Q13596 | 1:1:1:1 | CompleatCORUM | Compleat:HC2400CORUM:1091 | 9819414 |
| JAK2LEPR | O60674P48357 | 2:2 | PDB | PDB:6e2p | ||
| LEPRSNX1SNX2SNX4SNX6UBC | O60749O95219P0CG48P48357Q13596Q9UNH7 | 1:1:1:1:1:1 | CompleatCFinder | Compleat:HC3850 | ||
| BTNL8GLRBLEPROSBP2 | P48167P48357Q6UX41Q969R2 | 0:0:0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 27894104 |
Sequence, Structure & Domains
Sequences
Length
131
Mass
14,254
Sequence
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW
3D Structural Models
Domain & Motif Annotations
Protein Families
OB-RGRP/VPS55 family
Sequence Similarities
Belongs to the OB-RGRP/VPS55 family.
Clinical Relevance
Disease Involvement
Cancer-related genesFDA approved drug targetsObesity
Biomarker
Approved; Investigative
Drug Targets
FDA approved drug targets
Antibody