Protein detail
CLIC2
Chloride intracellular channel protein 2 (Glutaredoxin-like oxidoreductase CLIC2) (EC 1.8.-.-) (Glutaredoxin-like peroxidase CLIC2) (EC 1.11.1.-) (XAP121)
Entry name CLIC2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Chloride intracellular channel protein 2 (Glutaredoxin-like oxidoreductase CLIC2) (EC 1.8.-.-) (Glutaredoxin-like peroxidase CLIC2) (EC 1.11.1.-) (XAP121)
Protein Class (5)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsTransporters
Protein Function (5)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
Transmembrane
32..52; Helical; Note=After insertion into the membrane
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CLCNL2XAP121
Gene Description
Chloride intracellular channel 2
Chromosome
X
Position
155276211-155334657
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificstomach 1Brain Regional Specificchoroid plexusCell SpecificParietal cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (5)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
Reactome (6)
Canonical Pathways (3)
- M232 Pid ecadherin stabilization pathway
- M16 Pid insulin pathway
- M67 Pid arf6 trafficking pathway
Mediation Categories (3)
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence13
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | OmniPath |
Page 2 of 2Previous
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
247
Mass
28,356
Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
3D Structural Models
Turn
96..98; 112..115; 160..162; 240..242
Helix
31..43; 57..60; 83..93; 108..111; 116..125; 129..131; 132..151; 181..201; 210..220; 223..226; 232..239
Beta Strand
14..20; 24..27; 48..52; 68..70; 72..75; 78..80; 163..165; 172..178
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
30..33; G-site
Domain (CC)
Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as a chloride channel. The redox status of the active cysteine in Cys-X-X-Cys motif likely determines the capacity to adopt a soluble or membrane-inserted state. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.; DOMAIN: The active G-site has a dithiol Cys-X-X-Cys motif which mediates glutathione-dependent redox catalysis.
Domain (FT)
76..239; GST C-terminal
Region
1..96; Required for insertion into the membrane; 1..94; N-terminal; 95..106; Joint loop; 107..247; C-terminal; 151..171; Foot loop
Protein Families
Chloride channel CLIC family
Sequence Similarities
Belongs to the chloride channel CLIC family.
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40730843 | Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury. | No related sentences available |