Protein detail
NCAM2
Neural cell adhesion molecule 2 (N-CAM-2) (NCAM-2)
Entry name NCAM2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Neural cell adhesion molecule 2 (N-CAM-2) (NCAM-2)
Protein Class (2)
Plasma proteinsPredicted membrane proteins
Transmembrane
698..718; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MGC51008NCAM21
Gene Description
Neural cell adhesion molecule 2
Chromosome
21
Position
20998409-21543329
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue SpecificesophagusCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway5
Cellular Component (5)
Molecular Function
Biological Process (3)
KEGG (4)
Mediation Categories
Other mediation
Relations & Evidence42
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 4 of 4Previous
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation;Acoustic trapping | Mass spectrometry | 1 | 27487081 |
Sequence, Structure & Domains12
Sequences
Length
837
Mass
93,046
Sequence
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVTNHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15394-1; Sequence=Displayed; Name=2; IsoId=O15394-2; Sequence=VSP_056637, VSP_056638, VSP_056639
Alternative Sequence
1..18; MSLLLSFYLLGLLVSSGQ -> MVRSDSGGQVYLDYHNRQGLFVDWKYNEALYLEEGQPETYYRT (in isoform 2); 399; Y -> S (in isoform 2); 400..837; Missing (in isoform 2)
3D Structural Models
Turn
191..194; 261..264; 337..340; 605..607; 646..648
Helix
85..87; 178..180; 273..275; 372..374
Beta Strand
20..26; 28..33; 38..46; 49..54; 65..72; 75..80; 89..96; 98..100; 102..112; 116..119; 123..127; 132..134; 137..139; 145..150; 152..154; 163..165; 171..173; 182..190; 195..206; 210..212; 217..221; 222..224; 228..231; 233..235; 241..246; 254..260; 265..268; 277..285; 288..307; 310..312; 317..328; 331..336; 341..343; 350..352; 354..359; 362..369; 376..384; 387..397; 409..412; 418..422; 424..428; 431..436; 439..442; 449..453; 458..462; 469..479; 482..492; 500..507; 512..517; 527..536; 543..546; 548..550; 552..556; 564..575; 576..580; 584..587; 599..604; 608..613; 619..621; 625..631; 640..645; 650..653; 661..670; 678..683
3D Structure
NMR spectroscopy (2); X-ray crystallography (7)
Domain & Motif Annotations
Compositional Bias
764..785; Basic and acidic residues; 789..798; Low complexity; 799..814; Basic and acidic residues
Domain (FT)
21..108; Ig-like C2-type 1; 113..202; Ig-like C2-type 2; 208..297; Ig-like C2-type 3; 302..396; Ig-like C2-type 4; 401..491; Ig-like C2-type 5; 498..591; Fibronectin type-III 1; 593..688; Fibronectin type-III 2
Region
764..818; Disordered
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No abstract available |