Protein detail
COPT2
Protein SLC31A2 (Copper transporter 2) (hCTR2) (Solute carrier family 31 member 2)
Entry name COPT2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 4 | Transmembrane count 3 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Protein SLC31A2 (Copper transporter 2) (hCTR2) (Solute carrier family 31 member 2)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
23..43; Helical; 94..114; Helical; 120..140; Helical
Transmembrane Count
3
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
COPT2CTR2hCTR2
Gene Description
Solute carrier family 31 member 2
Chromosome
9
Position
113150976-113164140
Supporting publications (n)
4
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificintestineCell SpecificMyonucleiSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway6
Protein Function
Transporters:Transporter channels and pores
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Canonical Pathways (3)
- M240 Pid syndecan 2 pathway
- M94 Pid fas pathway
- M12 Pid rhoa pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence14
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western BlottingMass SpectrometryFlow Cytometry | 1 | 38207106 |
Sequence, Structure & Domains6
Sequences
Length
143
Mass
15,681
Sequence
MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA
Domain & Motif Annotations
Domain (CC)
The N-terminal domain may be involved in Cu(2+) acquisition from potential degradation products of proteins in the lysosome.
Protein Families (2)
- Copper transporter (Ctr) (TC 1.A.56) family
- SLC31A subfamily
Sequence Similarities
Belongs to the copper transporter (Ctr) (TC 1.A.56) family. SLC31A subfamily.
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |