Protein detail
CFLAR
CASP8 and FADD-like apoptosis regulator (Caspase homolog) (CASH) (Caspase-eight-related protein) (Casper) (Caspase-like apoptosis regulatory protein) (CLARP) (Cellular FLICE-like inhibitory protein) (c-FLIP) (FADD-like antiapoptotic molecule 1) (FLAME-1) (Inhibitor of FLICE) (I-FLICE) (MACH-related inducer of toxicity) (MRIT) (Usurpin) [Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12]
Entry name CFLAR | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesEnzymesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CASP8 and FADD-like apoptosis regulator (Caspase homolog) (CASH) (Caspase-eight-related protein) (Casper) (Caspase-like apoptosis regulatory protein) (CLARP) (Cellular FLICE-like inhibitory protein) (c-FLIP) (FADD-like antiapoptotic molecule 1) (FLAME-1) (Inhibitor of FLICE) (I-FLICE) (MACH-related inducer of toxicity) (MRIT) (Usurpin) [Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12]
Protein Class (3)
Cancer-related genesEnzymesPredicted intracellular proteins
Protein Function (4)
- Peptidases:Cysteine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (10)
c-FLIPCASHCASP8AP1CaspercFLIPCLARPFLAMEFLIPI-FLICEMRIT
Gene Description
CASP8 and FADD like apoptosis regulator
Chromosome
2
Position
201116154-201176687
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificpDCsSingle-Nuclei Brain SpecificleukocyteBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (4)
- Peptidases:Cysteine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (7)
- GO:0002020 protease binding
- GO:0005123 death receptor binding
- GO:0005515 protein binding
- GO:0008047 enzyme activator activity
- GO:0044877 protein-containing complex binding
- GO:0097199 cysteine-type endopeptidase activity involved in apoptotic signaling pathway
- GO:0097200 cysteine-type endopeptidase activity involved in execution phase of apoptosis
Biological Process (3)
KEGG (7)
Reactome (10)
- R-hsa-109581 apoptosis
- R-hsa-140534 caspase activation via death receptors in the presence of ligand
- R-hsa-5357769 caspase activation via extrinsic apoptotic signalling pathway
- R-hsa-73887 death receptor signaling
- R-hsa-5357801 programmed cell death
- R-hsa-5218859 regulated necrosis
- R-hsa-3371378 regulation by c flip
- R-hsa-5213460 ripk1 mediated regulated necrosis
- R-hsa-75893 tnf signaling
- R-hsa-75158 trail signaling
Canonical Pathways (3)
- M241 Pid rac1 reg pathway
- M81 Pid cdc42 pathway
- M164 Pid erbb1 downstream pathway
Mediation Categories (4)
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence25
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CFLAR | AKT1 | P31749 | S | 273 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19339247SIGNOR:19339247 |
| CFLAR | PRKCA | P17252 | S | 193 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CFLAR | PRKCB | P05771 | S | 193 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CFLAR | ROS1 | P08922 | T | 166 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:25675293 |
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (9)
9 records.
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Death induced signaling complex II (FADDCASP8CFLAR)cytosolicCD95L induced | CASP8CFLARFADD | O15519Q13158Q14790 | 4:3:3 | CompleatCORUMPDB | PDB:8yniCompleat:HC1309PDB:8ybxPDB:8yd8PDB:8yd7CORUM:5798 | 18635548 |
| MRIT complex | BCL2L1CASP8CFLAR | O15519Q07817Q14790 | 1:1:1 | CompleatCORUM | CORUM:5749Compleat:HC3429 | 9326610 |
| APAF1CASP1CASP10CASP2CASP3CASP4CASP6CASP7CASP8CFLARDSPHSPA5KRT18RB1TNFSF10 | O14727O15519P05783P06400P11021P15924P29466P42574P42575P49662P50591P55210P55212Q14790Q92851 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC6912 | ||
| CFLARDEDDSMAD3UBC | O15519O75618P0CG48P84022 | 1:1:1:1 | CompleatCFinder | Compleat:HC6627 | ||
| CFLARFOSNFKB1RELATPR | O15519P01100P12270P19838Q04206 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7805 | ||
| CFLARITCHMAP2K4UBC | O15519P0CG48P45985Q96J02 | 1:1:1:1 | CompleatCFinder | Compleat:HC6777 | ||
| CFLARPLIN5 | O15519Q00G26 | 0:0 | hu.MAP | |||
| CASP8CFLAR | O15519Q14790 | 6:4 | PDB | PDB:8ym4PDB:8ym5PDB:8ynnPDB:8ynkPDB:8ynmPDB:7deePDB:3h11PDB:8ym6PDB:8ynl |
Sequence, Structure & Domains
Sequences
Length
480
Mass
55,344
Sequence
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
Alternative Products
Event=Alternative splicing; Named isoforms=15; Name=1; Synonyms=FLIP-L, CLARP1, MRIT alpha-1, CASH alpha, I-FLICE 1, FLAME-1 gamma, Usurpin alpha; IsoId=O15519-1; Sequence=Displayed; Name=2; Synonyms=FLIP-S, CLARP2, MRIT beta-1, CASH beta; IsoId=O15519-2; Sequence=VSP_000828, VSP_000829; Name=3; Synonyms=MRIT alpha-2; IsoId=O15519-3; Sequence=VSP_000824, VSP_000838; Name=4; Synonyms=I-FLICE 2; IsoId=O15519-4; Sequence=VSP_000825; Name=5; Synonyms=I-FLICE 3; IsoId=O15519-5; Sequence=VSP_000840; Name=6; Synonyms=I-FLICE 4; IsoId=O15519-6; Sequence=VSP_000826, VSP_000841; Name=7; Synonyms=I-FLICE 5; IsoId=O15519-7; Sequence=VSP_000824, VSP_000827, VSP_000838; Name=8; Synonyms=FLAME-1 alpha; IsoId=O15519-8; Sequence=VSP_000830; Name=9; Synonyms=FLAME-1 beta; IsoId=O15519-9; Sequence=VSP_000830, VSP_000836, VSP_000837; Name=10; Synonyms=FLAME-1 delta; IsoId=O15519-10; Sequence=VSP_000834, VSP_000835; Name=11; Synonyms=Usurpin beta; IsoId=O15519-11; Sequence=VSP_000838; Name=12; Synonyms=Usurpin gamma; IsoId=O15519-12; Sequence=VSP_000832, VSP_000833; Name=13; IsoId=O15519-13; Sequence=VSP_000831; Name=14; IsoId=O15519-14; Sequence=VSP_000839; Name=15; IsoId=O15519-15; Sequence=VSP_000824
Alternative Sequence
1..245; Missing (in isoform 4); 1..96; Missing (in isoform 3, isoform 7 and isoform 15); 2..30; SAEVIHQVEEALDTDEKEMLLFLCRDVAI -> LERPPVCSKV (in isoform 6); 203..480; Missing (in isoform 13); 203..237; Missing (in isoform 8 and isoform 9); 203..221; LHNGRSKEQRLKEQLGAQQ -> MITPYAHCPDLKILGNCSM (in isoform 2); 203..221; LHNGRSKEQRLKEQLGAQQ -> E (in isoform 7); 222..480; Missing (in isoform 2); 265..292; ELLRDTFTSLGYEVQKFLHLSMHGISQI -> GWSAMAQSQLTAISTSQVQAILLPQPPE (in isoform 12); 266..300; LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP -> NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL (in isoform 10); 267..305; LRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDY -> CGVRGPAGGQQPLGGGWASDEECGIQGSEARAVHSSPRS (in isoform 9); 293..480; Missing (in isoform 12); 301..480; Missing (in isoform 10); 306..480; Missing (in isoform 9); 436..480; KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT -> GTIPGSGITESKDMHFSSLGCILLDVL (in isoform 11, isoform 7 and isoform 3); 436..480; Missing (in isoform 14); 449..480; YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT -> L (in isoform 5); 453..480; WNSRVSAKEKYYVWLQHTLRKKLILSYT -> SLEHTGGRY (in isoform 6)
3D Structural Models
Turn
25..28; 342..344
Helix
3..12; 15..24; 37..46; 52..61; 65..70; 76..85; 92..102; 106..116; 117..119; 131..140; 150..158; 162..175; 266..274; 286..297; 300..304; 333..340; 346..348; 410..412; 422..433; 439..454; 459..461
Beta Strand
239..241; 249..260; 276..283; 306..317; 353..361; 400..409; 463..469
3D Structure
Electron microscopy (6); NMR spectroscopy (4); X-ray crystallography (7)
Domain & Motif Annotations
Domain (CC)
The caspase domain lacks the active site residues involved in catalysis.
Domain (FT)
1..73; DED 1; 92..170; DED 2
Region
1..435; Not proteolytically processed and involved in apoptosis inhibition; 1..305; Interaction with CASP8 propeptide; 1..227; Interaction with FADD; 1..195; Interaction with CASP8; 192..480; Interaction with TRAF1 and TRAF2; 192..435; Interaction with CASP3; 217..480; Interaction with CASP8 subunits p18 and p10; 263..358; Caspase; 370..480; Interaction with CASP8
Protein Families
Peptidase C14A family
Sequence Similarities
Belongs to the peptidase C14A family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drugs (8)
Interaction Protein (3)
ENSG00000003400ENSG00000056558ENSG00000064012
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No related sentences available |