Protein detail

MTSS1

Protein MTSS 1 (Metastasis suppressor YGL-1) (Metastasis suppressor protein 1) (Missing in metastasis protein)

Entry name MTSS1	UniProt ID O43312	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein MTSS 1 (Metastasis suppressor YGL-1) (Metastasis suppressor protein 1) (Missing in metastasis protein)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000170873

Entrez Gene Symbol

MTSS1

Gene Synonym (4)

KIAA0429MIMMIMAMIMB

Gene Description

MTSS I-BAR domain containing 1

Chromosome

Position

124550784-124728473

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization6

Tissue Specificblood vesselCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificendothelial cellSecretome LocationSecreted to extracellular matrixSecretome FunctionEnzyme

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (5)

Molecular Function (6)

Biological Process (3)

KEGG

hsa04517 IgSF CAM signaling

Canonical Pathways (3)

M5060 Sa fas signaling
M7997 Sa caspase cascade
M197 Pid hiv nef pathway

Mediation Categories

Fusion and delivery mediation

Relations & Evidence12

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MTSS1	CSNK1D	P48730	S	322	phosphorylation	PhosphoSite_MIMPMIMPProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:24318128

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (6)

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MTSS1	O43312	GLI1	P08151	Yes	Yes	No	WangSIGNORSignaLink3	SignaLink3:15545630 SignaLink3:23331499 SIGNOR:15545630 SIGNOR:17845852
MTSS1	O43312	GLIS2	Q9BZE0	Yes	Yes	No	SignaLink3	SignaLink3:23331499 SignaLink3:15545630
MTSS1	O43312	SUFU	Q9UMX1	Yes	Yes	No	SIGNORSignaLink3	SignaLink3:23331499 SIGNOR:15545630 SignaLink3:15545630
MTSS1	O43312	RAC1	P63000	Yes	Yes	No	SIGNORSignaLink3	SignaLink3:23331499 SIGNOR:16280553 SignaLink3:16280553
KC1D	P48730	MTSS1	O43312	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperELMREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:24318128 PhosphoSite:24318128 SIGNOR:24318128 ELM:24318128
	COMPLEX:P63208_Q13616_Q9Y297	MTSS1	O43312	Yes	No	Yes	SIGNOR	SIGNOR:24318128

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31737616 38343172

Sequence, Structure & Domains14

Sequences

Length

755

Mass

82,251

Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O43312-1; Sequence=Displayed; Name=2; IsoId=O43312-2; Sequence=VSP_007420, VSP_007421; Name=3; IsoId=O43312-4; Sequence=VSP_016216; Name=4; IsoId=O43312-5; Sequence=VSP_054702

Alternative Sequence

1..200; Missing (in isoform 2); 153; K -> KVDTL (in isoform 4); 345..426; Missing (in isoform 2); 346..409; LSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSW -> NSSSSASSEASETCQSVSECSSPTSVSSGSTMGAWVSTE (in isoform 3)

3D Structural Models

Helix

729..737

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

443..453; Low complexity; 608..623; Low complexity; 656..671; Polar residues

Coiled Coil

108..155

Domain (CC)

The WH2 motif at the C-terminus binds to actin monomers.

Domain (FT)

1..250; IMD; 727..744; WH2

Region

139..159; Disordered; 255..305; Disordered; 327..351; Disordered; 428..470; Disordered; 490..513; Disordered; 563..755; Disordered

Protein Families

MTSS family

Sequence Similarities

Belongs to the MTSS family.

Clinical Relevance2

Disease Involvement

Tumor suppressor

Antibody (3)

HPA019613 HPA064003 HPA075540

Supporting Publications1

PMID	Title	Abstract
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available