Protein detail
MTSS1
Protein MTSS 1 (Metastasis suppressor YGL-1) (Metastasis suppressor protein 1) (Missing in metastasis protein)
Entry name MTSS1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein MTSS 1 (Metastasis suppressor YGL-1) (Metastasis suppressor protein 1) (Missing in metastasis protein)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
KIAA0429MIMMIMAMIMB
Gene Description
MTSS I-BAR domain containing 1
Chromosome
8
Position
124550784-124728473
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificendothelial cellSecretome LocationSecreted to extracellular matrixSecretome FunctionEnzyme
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (5)
Molecular Function (6)
Biological Process (3)
Canonical Pathways (3)
- M5060 Sa fas signaling
- M7997 Sa caspase cascade
- M197 Pid hiv nef pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence12
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| MTSS1 | CSNK1D | P48730 | S | 322 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24318128 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MTSS1 | O43312 | GLI1 | P08151 | Yes | Yes | WangSIGNORSignaLink3 | SignaLink3:15545630SignaLink3:23331499SIGNOR:15545630SIGNOR:17845852 | |
| MTSS1 | O43312 | GLIS2 | Q9BZE0 | Yes | Yes | SignaLink3 | SignaLink3:23331499SignaLink3:15545630 | |
| MTSS1 | O43312 | SUFU | Q9UMX1 | Yes | Yes | SIGNORSignaLink3 | SignaLink3:23331499SIGNOR:15545630SignaLink3:15545630 | |
| MTSS1 | O43312 | RAC1 | P63000 | Yes | Yes | SIGNORSignaLink3 | SignaLink3:23331499SIGNOR:16280553SignaLink3:16280553 | |
| KC1D | P48730 | MTSS1 | O43312 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperELMREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24318128PhosphoSite:24318128SIGNOR:24318128ELM:24318128 | |
| COMPLEX:P63208_Q13616_Q9Y297 | MTSS1 | O43312 | Yes | Yes | SIGNOR | SIGNOR:24318128 |
Sequence, Structure & Domains
Sequences
Length
755
Mass
82,251
Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O43312-1; Sequence=Displayed; Name=2; IsoId=O43312-2; Sequence=VSP_007420, VSP_007421; Name=3; IsoId=O43312-4; Sequence=VSP_016216; Name=4; IsoId=O43312-5; Sequence=VSP_054702
Alternative Sequence
1..200; Missing (in isoform 2); 153; K -> KVDTL (in isoform 4); 345..426; Missing (in isoform 2); 346..409; LSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSW -> NSSSSASSEASETCQSVSECSSPTSVSSGSTMGAWVSTE (in isoform 3)
3D Structural Models
Helix
729..737
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
443..453; Low complexity; 608..623; Low complexity; 656..671; Polar residues
Coiled Coil
108..155
Domain (CC)
The WH2 motif at the C-terminus binds to actin monomers.
Domain (FT)
1..250; IMD; 727..744; WH2
Region
139..159; Disordered; 255..305; Disordered; 327..351; Disordered; 428..470; Disordered; 490..513; Disordered; 563..755; Disordered
Protein Families
MTSS family
Sequence Similarities
Belongs to the MTSS family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |