Protein detail

LAT

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein symbol LAT	UniProt ID O43561	EVMP score 0.63
Frequency 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Basic Information

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

Position

28984826-28990784

Frequency

EVMP Score

0.63

Fluorescence & Localization

Function & Pathway

Protein Function

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	MAPK8	P45983	T	184	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:15192708 SIGNOR:15192708
LAT	MAPK8	P45983	T	155	phosphorylation	PhosphoSite
LAT	MAPK8	P45983	T	191	phosphorylation	MIMPPhosphoSite_MIMP
LAT	ZAP70	P43403	Y	220	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	KEA:15659558 ProtMapper:11368773 KEA:11368773 ProtMapper:18779373 ProtMapper:22507872 SIGNOR:11368773 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	156	phosphorylation	SIGNORProtMapperHPRDKEASIGNOR_ProtMapper	HPRD:11368773 ProtMapper:11368773 KEA:11368773 SIGNOR:11368773
LAT	ZAP70	P43403	Y	255	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 SIGNOR:11368773 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	161	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 SIGNOR:11368773 ProtMapper:23150273 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	200	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 ProtMapper:22507872 SIGNOR:11368773 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	127	phosphorylation	HPRDPhosphoSiteKEA	HPRD:11368773 KEA:11368773
LAT	ZAP70	P43403	Y	132	phosphorylation	HPRDPhosphoSiteKEA	HPRD:11368773 KEA:11368773

Page 1 of 6Next

Ligand-Receptor Signaling

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No

Page 2 of 2Previous

Regulatory Interaction Network

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTPRJ	Q12913	LAT	O43561	Yes	No	Yes	WangSIGNORDEPODHPRDSPIKE_LCSPIKE	DEPOD:11259588 HPRD:11259588 SPIKE:11259588 SIGNOR:11259588 SPIKE_LC:11259588
LAT	O43561	PLCG1	P19174	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTSignaLink3BioGRIDIntActLMPIDSPIKE_LCLit-BM-17SPIKETCRcuration_SignaLink3	HINT:27221712 Lit-BM-17:11368773 IntAct:16938345 SignaLink3:23109003 SignaLink3:15286727 HPRD:9729044 SPIKE_LC:16467851 IntAct:9489702 NetPath:10811803 SignaLink3:11709089 SPIKE:10811803 SPIKE:16467851 Lit-BM-17:9489702 HINT:10811803 LMPID:10811803 SIGNOR:11368773 HINT:9489702 SignaLink3:15219999 SPIKE_LC:10811803 HINT:16938345 HINT:15696170 IntAct:24642916 SPIKE_LC:16938345 IntAct:10811803 HINT:16467851 Lit-BM-17:10811803 HINT:11368773 LMPID:11368773 HINT:24642916 HPRD:11368773 SignaLink3:12941616 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:27221712 BioGRID:9729044 SPIKE:16938345 Lit-BM-17:16467851 SPIKE_LC:16713569 HPRD:16467851
LAT	O43561	VAV	P15498	Yes	Yes	No	WangNetPathSIGNORHPRDHINTSignaLink3Li2012SPIKE_LCSPIKETCRcuration_SignaLink3	SPIKE:16713569 SignaLink3:23109003 NetPath:12186560 HINT:12186560 SPIKE_LC:12186560 HINT:11368773 SPIKE:12186560 SPIKE_LC:16713569 HPRD:11368773 SignaLink3:12186560 SIGNOR:11368773
LAT	O43561	GAB2	Q9UQC2	Yes	No	No	WangNetPathHPRDSignaLink3SPIKE_LCSPIKETCRcuration_SignaLink3	HPRD:11572860 SignaLink3:23109003 SignaLink3:12640133 NetPath:11572860 SignaLink3:11572860 SPIKE_LC:11572860 SPIKE:11572860
LAT	O43561	GRB2	P62993	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTBioGRIDIntActDIPSPIKE_LCLit-BM-17SPIKE	Lit-BM-17:12186560 Lit-BM-17:11368773 IntAct:16938345 NetPath:12186560 HINT:12186560 SIGNOR:23150273 HINT:7510700 NetPath:17043143 SIGNOR:10811803 IntAct:9489702 DIP:16906159 Lit-BM-17:16906159 HPRD:16906159 Lit-BM-17:9489702 HINT:10811803 HINT:16906159 HPRD:9489702 BioGRID:8063801 HINT:8063801 HINT:9489702 HINT:16938345 SPIKE_LC:16938345 IntAct:10811803 SPIKE_LC:12186560 Lit-BM-17:10811803 SPIKE:12186560 SPIKE:16906159 HINT:7516467 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:8063801 SPIKE_LC:16906159 SPIKE:16938345 IntAct:16906159 SPIKE_LC:16713569
LAT	O43561	VAV3	Q9UKW4	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:12186560
LAT	O43561		Q6FHA6	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:10021361 SignaLink3:23109003 SignaLink3:15219999
ZAP70	P43403	LAT	O43561	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEASignaLink3phosphoELM_KEAHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteTCRcuration_SignaLink3Sparser_ProtMapperSPIKE_LCHPRD-phos	KEA:15659558 ProtMapper:11368773 PhosphoSite:11395491 SignaLink3:23109003 PhosphoSite:27896837 HINT:12186560 SIGNOR:29915297 KEA:10811803 ProtMapper:27700984 PhosphoSite:12496416 PhosphoSite:30510001 ProtMapper:24119664 PhosphoSite:24642916 ProtMapper:31611699 ProtMapper:29915297 PhosphoSite:15100278 ProtMapper:23758320 SIGNOR:11368773 KEA:11368773 ProtMapper:35095913 ProtMapper:18779373 HPRD-phos:11368773 PhosphoSite:11368773 ProtMapper:22507872 ProtMapper:23150273 HINT:11368773 HPRD:11368773 PhosphoSite:33931484 SPIKE_LC:16906159 PhosphoSite:15029250 PhosphoSite:24412752 SignaLink3:15084594 PhosphoSite:34161759
LAT	O43561	3BP2	P78314	Yes	No	No	HPRDHINTSignaLink3TCRcuration_SignaLink3	HINT:9846481 SignaLink3:23109003 HPRD:11390470 SignaLink3:15751964 HINT:17306257
LAT	O43561	P85A	P27986	Yes	Yes	No	WangNetPathSIGNORHINTSignaLink3SPIKE_LCTCRcuration_SignaLink3	SignaLink3:19132916 NetPath:9489702 SignaLink3:23109003 SignaLink3:14696041 HINT:10811803 HINT:11368773 SPIKE_LC:16713569 HINT:7544353 SIGNOR:11368773

Page 1 of 3Next

Protein Complex Composition

67 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
mitochondrial pyruvate dehydrogenase complex	BCKDHA BCKDK DLAT DLD PDHA1 PDHA2 PDHB PDHX PDK3 PDP1 PDP2	O00330 O14874 P08559 P09622 P10515 P11177 P12694 P29803 Q15120 Q9P0J1 Q9P2J9	1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3552	16643908
tPA-PAI-1 complex	PLAT SERPINE1	P00750 P05121	1:1	ComplexPortalPDB	PDB:5zlzPDB:5brrintact:EBI-11891578	26324706 14755292
	FRMD3 LCLAT1	A2A2Y4 Q6UWP7	0:0	hu.MAP2
	BCKDHA BCKDHB BCKDK DLAT PDHA1 PDHB PDHX PDK1 PDK2 PDK3 PDK4 UBC	O00330 O14874 P08559 P0CG48 P10515 P11177 P12694 P21953 Q15118 Q15119 Q15120 Q16654	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5533
	BCKDK DLAT PDHA1 PDHB PDHX PDK1 PDK2 PDK3 PDK4 PDP1 UBC	O00330 O14874 P08559 P0CG48 P10515 P11177 Q15118 Q15119 Q15120 Q16654 Q9P0J1	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8549
	COX5B DLAT ERLEC1 MT-ND5 OGDH PDHA1 PDHA2 PDHB PDHX	O00330 P03915 P08559 P10515 P10606 P11177 P29803 Q02218 Q96DZ1	0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_567
	DLAT DLD PCCA PDHA1 PDHB PDHX PITRM1 UBC USP8	O00330 P05165 P08559 P09622 P0CG48 P10515 P11177 P40818 Q5JRX3	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7115
	DLAT DLD DLST IMMT OGDH PDHA1 PDHB PDHX PITRM1 UBC	O00330 P08559 P09622 P0CG48 P10515 P11177 P36957 Q02218 Q16891 Q5JRX3	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9067
	DLAT DLD MCCC1 PDHA1 PDHB PDHX PITRM1 UBC USP8	O00330 P08559 P09622 P0CG48 P10515 P11177 P40818 Q5JRX3 Q96RQ3	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8680
	DLAT DLD LIG3 OGDH PDHA1 PDHB PDHX PITRM1 TDP1 UBC	O00330 P08559 P09622 P0CG48 P10515 P11177 P49916 Q02218 Q5JRX3 Q9NUW8	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8469

Page 2 of 7Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

Interaction Dataset

intact_biogrid