Protein detail

LAT

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Entry name LAT	UniProt ID O43561	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class (6)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

Position

28984826-28990784

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization1

Function & Pathway7

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component (8)

Molecular Function (4)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (14)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence166

Enzyme-Mediated Modification (60)

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	MAPK8	P45983	T	184	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:15192708 SIGNOR:15192708
LAT	MAPK8	P45983	T	155	phosphorylation	PhosphoSite
LAT	MAPK8	P45983	T	191	phosphorylation	MIMPPhosphoSite_MIMP
LAT	ZAP70	P43403	Y	220	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	KEA:15659558 ProtMapper:11368773 KEA:11368773 ProtMapper:18779373 ProtMapper:22507872 SIGNOR:11368773 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	156	phosphorylation	SIGNORProtMapperHPRDKEASIGNOR_ProtMapper	HPRD:11368773 ProtMapper:11368773 KEA:11368773 SIGNOR:11368773
LAT	ZAP70	P43403	Y	255	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 SIGNOR:11368773 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	161	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 SIGNOR:11368773 ProtMapper:23150273 ProtMapper:27700984 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	200	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:11368773 KEA:11368773 ProtMapper:22507872 SIGNOR:11368773 HPRD:11368773 ProtMapper:23758320
LAT	ZAP70	P43403	Y	127	phosphorylation	HPRDPhosphoSiteKEA	HPRD:11368773 KEA:11368773
LAT	ZAP70	P43403	Y	132	phosphorylation	HPRDPhosphoSiteKEA	HPRD:11368773 KEA:11368773

Page 1 of 6Next

Ligand-Receptor Signaling (15)

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No

Page 2 of 2Previous

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LAT	O43561		Q96EV4	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:19132916 SignaLink3:14696041
MK08	P45983	LAT	O43561	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapper	ProtMapper:15192708 SIGNOR:15192708
STK25	O00506	LAT	O43561	Yes	Yes	No	SIGNOR	SIGNOR:30948712
STK4	Q13043	LAT	O43561	Yes	Yes	No	SIGNOR	SIGNOR:26456820
TRAF6	Q9Y4K3	LAT	O43561	Yes	Yes	No	SIGNORBioGRID	BioGRID:25907557 SIGNOR:23514740
PTN1	P18031	LAT	O43561	Yes	No	Yes	DOMINOWangSIGNORDEPODHPRDInnateDBSPIKE_LC	DOMINO:12857726 SIGNOR:12857726 SPIKE_LC:12857726 DEPOD:12857726 HPRD:12857726 InnateDB:12857726
LAT	O43561		COMPLEX:P27986_P42336	Yes	Yes	No	SIGNOR	SIGNOR:11368773
FYN	P06241	LAT	O43561	Yes	Yes	No	iPTMnetSIGNORProtMapperSIGNOR_ProtMapperWang	ProtMapper:16938345 SIGNOR:16938345
LAT	O43561	PK3CA	P42336	Yes	Yes	No	WangSIGNOR	SIGNOR:11368773
MK03	P27361	LAT	O43561	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite	ProtMapper:15192708 SIGNOR:15192708 PhosphoSite:15192708

Page 2 of 3Previous Next

Protein Complex Composition (67)

67 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
GRAP2 LAT LCP2 VAV2	O43561 O75791 P52735 Q13094	0:0:0:0	KEGG-MEDICUS
GRAP2 LAT LCP2 VAV3	O43561 O75791 Q13094 Q9UKW4	0:0:0:0	KEGG-MEDICUS
AP1B1 AP1G1 AP1M1 AP1M2 AP1S1 AP1S2 AP2B1 CLINT1 CLTB CLTC CTBP1 GGA3 LCLAT1 UBC	O43747 P09497 P0CG48 P56377 P61966 P63010 Q00610 Q10567 Q13363 Q14677 Q6UWP7 Q9BXS5 Q9NZ52 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7641
CDK1 DMPK LATS1 LATS2 MOB1A MOB1B NUAK1 RPS6KB1 STK4 UBC	O60285 O95835 P06493 P0CG48 P23443 Q09013 Q13043 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4389
LATS1 LATS2 LIMK1 LIMK2 MOB1A MOB1B NUAK1 ROCK1 STK4	O60285 O95835 P53667 P53671 Q13043 Q13464 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7732
LATS1 LATS2 MOB1A MOB1B NUAK1 STK4	O60285 O95835 Q13043 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6116
FRYL LATS1 LATS2 MOB1A MOB1B STK4	O94915 O95835 Q13043 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5150
CCNB1 CCNB2 CDC25A CDK1 CDK2 CDKN3 LATS1 LATS2 MOB1A MOB1B ROCK1 STK4 UBC	O95067 O95835 P06493 P0CG48 P14635 P24941 P30304 Q13043 Q13464 Q16667 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5368
CCNB2 CDK1 CDKN3 LATS1 LATS2 MOB1A MOB1B ROCK1 STK4	O95067 O95835 P06493 Q13043 Q13464 Q16667 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7613
AURKB CCNB2 CDK1 CDKN3 LATS1 LATS2 MOB1A MOB1B STK4	O95067 O95835 P06493 Q13043 Q16667 Q7L9L4 Q96GD4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6382

Page 4 of 7Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains7

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance6

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody (4)

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein (5)

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Abstract
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
36736734	Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available