Protein detail

LAT

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein symbol LAT	UniProt ID O43561	EVMP score 0.63
Frequency 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Basic Information

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

Position

28984826-28990784

Frequency

EVMP Score

0.63

Fluorescence & Localization

Function & Pathway

Protein Function

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	ITK	Q08881	Y	70	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	161	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	220	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	255	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	110	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	200	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	36	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	45	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	156	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702
LAT	ITK	Q08881	Y	64	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:12186560 ProtMapper:11368773 ProtMapper:9489702

Page 5 of 6Previous Next

Ligand-Receptor Signaling

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No

Page 1 of 2Next

Regulatory Interaction Network

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTPRJ	Q12913	LAT	O43561	Yes	No	Yes	WangSIGNORDEPODHPRDSPIKE_LCSPIKE	DEPOD:11259588 HPRD:11259588 SPIKE:11259588 SIGNOR:11259588 SPIKE_LC:11259588
LAT	O43561	PLCG1	P19174	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTSignaLink3BioGRIDIntActLMPIDSPIKE_LCLit-BM-17SPIKETCRcuration_SignaLink3	HINT:27221712 Lit-BM-17:11368773 IntAct:16938345 SignaLink3:23109003 SignaLink3:15286727 HPRD:9729044 SPIKE_LC:16467851 IntAct:9489702 NetPath:10811803 SignaLink3:11709089 SPIKE:10811803 SPIKE:16467851 Lit-BM-17:9489702 HINT:10811803 LMPID:10811803 SIGNOR:11368773 HINT:9489702 SignaLink3:15219999 SPIKE_LC:10811803 HINT:16938345 HINT:15696170 IntAct:24642916 SPIKE_LC:16938345 IntAct:10811803 HINT:16467851 Lit-BM-17:10811803 HINT:11368773 LMPID:11368773 HINT:24642916 HPRD:11368773 SignaLink3:12941616 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:27221712 BioGRID:9729044 SPIKE:16938345 Lit-BM-17:16467851 SPIKE_LC:16713569 HPRD:16467851
LAT	O43561	VAV	P15498	Yes	Yes	No	WangNetPathSIGNORHPRDHINTSignaLink3Li2012SPIKE_LCSPIKETCRcuration_SignaLink3	SPIKE:16713569 SignaLink3:23109003 NetPath:12186560 HINT:12186560 SPIKE_LC:12186560 HINT:11368773 SPIKE:12186560 SPIKE_LC:16713569 HPRD:11368773 SignaLink3:12186560 SIGNOR:11368773
LAT	O43561	GAB2	Q9UQC2	Yes	No	No	WangNetPathHPRDSignaLink3SPIKE_LCSPIKETCRcuration_SignaLink3	HPRD:11572860 SignaLink3:23109003 SignaLink3:12640133 NetPath:11572860 SignaLink3:11572860 SPIKE_LC:11572860 SPIKE:11572860
LAT	O43561	GRB2	P62993	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTBioGRIDIntActDIPSPIKE_LCLit-BM-17SPIKE	Lit-BM-17:12186560 Lit-BM-17:11368773 IntAct:16938345 NetPath:12186560 HINT:12186560 SIGNOR:23150273 HINT:7510700 NetPath:17043143 SIGNOR:10811803 IntAct:9489702 DIP:16906159 Lit-BM-17:16906159 HPRD:16906159 Lit-BM-17:9489702 HINT:10811803 HINT:16906159 HPRD:9489702 BioGRID:8063801 HINT:8063801 HINT:9489702 HINT:16938345 SPIKE_LC:16938345 IntAct:10811803 SPIKE_LC:12186560 Lit-BM-17:10811803 SPIKE:12186560 SPIKE:16906159 HINT:7516467 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:8063801 SPIKE_LC:16906159 SPIKE:16938345 IntAct:16906159 SPIKE_LC:16713569
LAT	O43561	VAV3	Q9UKW4	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:12186560
LAT	O43561		Q6FHA6	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:10021361 SignaLink3:23109003 SignaLink3:15219999
ZAP70	P43403	LAT	O43561	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEASignaLink3phosphoELM_KEAHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteTCRcuration_SignaLink3Sparser_ProtMapperSPIKE_LCHPRD-phos	KEA:15659558 ProtMapper:11368773 PhosphoSite:11395491 SignaLink3:23109003 PhosphoSite:27896837 HINT:12186560 SIGNOR:29915297 KEA:10811803 ProtMapper:27700984 PhosphoSite:12496416 PhosphoSite:30510001 ProtMapper:24119664 PhosphoSite:24642916 ProtMapper:31611699 ProtMapper:29915297 PhosphoSite:15100278 ProtMapper:23758320 SIGNOR:11368773 KEA:11368773 ProtMapper:35095913 ProtMapper:18779373 HPRD-phos:11368773 PhosphoSite:11368773 ProtMapper:22507872 ProtMapper:23150273 HINT:11368773 HPRD:11368773 PhosphoSite:33931484 SPIKE_LC:16906159 PhosphoSite:15029250 PhosphoSite:24412752 SignaLink3:15084594 PhosphoSite:34161759
LAT	O43561	3BP2	P78314	Yes	No	No	HPRDHINTSignaLink3TCRcuration_SignaLink3	HINT:9846481 SignaLink3:23109003 HPRD:11390470 SignaLink3:15751964 HINT:17306257
LAT	O43561	P85A	P27986	Yes	Yes	No	WangNetPathSIGNORHINTSignaLink3SPIKE_LCTCRcuration_SignaLink3	SignaLink3:19132916 NetPath:9489702 SignaLink3:23109003 SignaLink3:14696041 HINT:10811803 HINT:11368773 SPIKE_LC:16713569 HINT:7544353 SIGNOR:11368773

Page 1 of 3Next

Protein Complex Composition

67 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CCNB2 CDK1 CDKN3 KMT2E LATS1 LATS2 MOB1A MOB1B MOB2 STK38	O95067 O95835 P06493 Q15208 Q16667 Q70IA6 Q7L9L4 Q8IZD2 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5155
ABL1 H4C4 LATS1 LATS2 MOB1B SAV1 STK3	O95835 P00519 P62805 Q13188 Q7L9L4 Q9H4B6 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8421
CCNA2 CCNE1 CDC25A CDK1 CDK2 CDK3 CDKN3 CKS1B CKS2 LATS1 LATS2 MOB1B UBC	O95835 P06493 P0CG48 P20248 P24864 P24941 P30304 P33552 P61024 Q00526 Q16667 Q7L9L4 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3869
ACTA1 CCNE1 CDC25A CDK1 CDK2 CDKN3 LATS1 LATS2 MARK4 MOB1A MOB1B UBC	O95835 P06493 P0CG48 P24864 P24941 P30304 P68133 Q16667 Q7L9L4 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4583
ACADVL CDK1 LATS1 LATS2 MOB1A MOB1B UBC	O95835 P06493 P0CG48 P49748 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5778
AJUBA CCNE1 CDC25A CDK1 CDK2 CDKN3 LATS1 LATS2 MARK4 MOB1A MOB1B	O95835 P06493 P24864 P24941 P30304 Q16667 Q7L9L4 Q96IF1 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9816
LATS1 LATS2 MOB1A MOB1B MOB2 PRPH STK38L	O95835 P41219 Q70IA6 Q7L9L4 Q9H8S9 Q9NRM7 Q9Y2H1	0:0:0:0:0:0:0	hu.MAP2
ACTA1 AJUBA LATS1 LATS2 MARK4 MOB1A MOB1B	O95835 P68133 Q7L9L4 Q96IF1 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7639
CNKSR1 LATS1 LATS2 MOB1A MOB1B STK3 STK4	O95835 Q13043 Q13188 Q7L9L4 Q969H4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8697
LATS1 LATS2 MOB1A MOB1B MOB2 STK38 STK4	O95835 Q13043 Q15208 Q70IA6 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5005

Page 5 of 7Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

Interaction Dataset

intact_biogrid