Protein detail

LAT

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Entry name LAT	UniProt ID O43561	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class (6)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

Position

28984826-28990784

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization1

Function & Pathway7

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component (8)

Molecular Function (4)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (14)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence166

Enzyme-Mediated Modification (60)

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	ABL1	P00519	Y	161	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:19290927
LAT	PLCG1	P19174	Y	161	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:25870599
LAT	TRAF6	Q9Y4K3	Y	220	phosphorylation	Sparser_ProtMapperProtMapper
LAT	GRB2	P62993	Y	255	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:25870599
LAT	ITGAL	P20701	Y	200	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:28699640
LAT	ATM	Q13315	S	224	phosphorylation	KEA	KEA:17570479
LAT	CDK1	P06493	S	84	phosphorylation	KEA	KEA:17570479
LAT	GSK3B	P49841	S	84	phosphorylation	KEA	KEA:17570479
LAT	MAPK14	Q16539	S	84	phosphorylation	KEA	KEA:17570479
LAT	PRKDC	P78527	S	224	phosphorylation	KEA	KEA:17570479

Page 6 of 6Previous

Ligand-Receptor Signaling (15)

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No

Page 1 of 2Next

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LAT	O43561		Q96EV4	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:19132916 SignaLink3:14696041
MK08	P45983	LAT	O43561	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapper	ProtMapper:15192708 SIGNOR:15192708
STK25	O00506	LAT	O43561	Yes	Yes	No	SIGNOR	SIGNOR:30948712
STK4	Q13043	LAT	O43561	Yes	Yes	No	SIGNOR	SIGNOR:26456820
TRAF6	Q9Y4K3	LAT	O43561	Yes	Yes	No	SIGNORBioGRID	BioGRID:25907557 SIGNOR:23514740
PTN1	P18031	LAT	O43561	Yes	No	Yes	DOMINOWangSIGNORDEPODHPRDInnateDBSPIKE_LC	DOMINO:12857726 SIGNOR:12857726 SPIKE_LC:12857726 DEPOD:12857726 HPRD:12857726 InnateDB:12857726
LAT	O43561		COMPLEX:P27986_P42336	Yes	Yes	No	SIGNOR	SIGNOR:11368773
FYN	P06241	LAT	O43561	Yes	Yes	No	iPTMnetSIGNORProtMapperSIGNOR_ProtMapperWang	ProtMapper:16938345 SIGNOR:16938345
LAT	O43561	PK3CA	P42336	Yes	Yes	No	WangSIGNOR	SIGNOR:11368773
MK03	P27361	LAT	O43561	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite	ProtMapper:15192708 SIGNOR:15192708 PhosphoSite:15192708

Page 2 of 3Previous Next

Protein Complex Composition (67)

67 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CCNB2 CDK1 CDKN3 KMT2E LATS1 LATS2 MOB1A MOB1B MOB2 STK38	O95067 O95835 P06493 Q15208 Q16667 Q70IA6 Q7L9L4 Q8IZD2 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5155
ABL1 H4C4 LATS1 LATS2 MOB1B SAV1 STK3	O95835 P00519 P62805 Q13188 Q7L9L4 Q9H4B6 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8421
CCNA2 CCNE1 CDC25A CDK1 CDK2 CDK3 CDKN3 CKS1B CKS2 LATS1 LATS2 MOB1B UBC	O95835 P06493 P0CG48 P20248 P24864 P24941 P30304 P33552 P61024 Q00526 Q16667 Q7L9L4 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3869
ACTA1 CCNE1 CDC25A CDK1 CDK2 CDKN3 LATS1 LATS2 MARK4 MOB1A MOB1B UBC	O95835 P06493 P0CG48 P24864 P24941 P30304 P68133 Q16667 Q7L9L4 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4583
ACADVL CDK1 LATS1 LATS2 MOB1A MOB1B UBC	O95835 P06493 P0CG48 P49748 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5778
AJUBA CCNE1 CDC25A CDK1 CDK2 CDKN3 LATS1 LATS2 MARK4 MOB1A MOB1B	O95835 P06493 P24864 P24941 P30304 Q16667 Q7L9L4 Q96IF1 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9816
LATS1 LATS2 MOB1A MOB1B MOB2 PRPH STK38L	O95835 P41219 Q70IA6 Q7L9L4 Q9H8S9 Q9NRM7 Q9Y2H1	0:0:0:0:0:0:0	hu.MAP2
ACTA1 AJUBA LATS1 LATS2 MARK4 MOB1A MOB1B	O95835 P68133 Q7L9L4 Q96IF1 Q96L34 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7639
CNKSR1 LATS1 LATS2 MOB1A MOB1B STK3 STK4	O95835 Q13043 Q13188 Q7L9L4 Q969H4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8697
LATS1 LATS2 MOB1A MOB1B MOB2 STK38 STK4	O95835 Q13043 Q15208 Q70IA6 Q7L9L4 Q9H8S9 Q9NRM7	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5005

Page 5 of 7Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains7

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance6

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody (4)

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein (5)

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Abstract
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
36736734	Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available