Protein detail
LAT
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein symbol LAT | UniProt ID | EVMP score 0.63 |
Frequency 6 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins |
Basic Information
Protein Names
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein Class
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Transmembrane
5..27; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
LAT1
Gene Description
Linker for activation of T cells
Chromosome
16
Position
28984826-28990784
Frequency
6
EVMP Score
0.63
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-202403 tcr signaling
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
60 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LAT | MAPK8 | P45983 | T | 184 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:15192708SIGNOR:15192708 |
| LAT | MAPK8 | P45983 | T | 155 | phosphorylation | PhosphoSite | |
| LAT | MAPK8 | P45983 | T | 191 | phosphorylation | MIMPPhosphoSite_MIMP | |
| LAT | ZAP70 | P43403 | Y | 220 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper | KEA:15659558ProtMapper:11368773KEA:11368773ProtMapper:18779373ProtMapper:22507872SIGNOR:11368773ProtMapper:27700984HPRD:11368773ProtMapper:23758320 |
| LAT | ZAP70 | P43403 | Y | 156 | phosphorylation | SIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:11368773ProtMapper:11368773KEA:11368773SIGNOR:11368773 |
| LAT | ZAP70 | P43403 | Y | 255 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:11368773KEA:11368773SIGNOR:11368773ProtMapper:27700984HPRD:11368773ProtMapper:23758320 |
| LAT | ZAP70 | P43403 | Y | 161 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:11368773KEA:11368773SIGNOR:11368773ProtMapper:23150273ProtMapper:27700984HPRD:11368773ProtMapper:23758320 |
| LAT | ZAP70 | P43403 | Y | 200 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:11368773KEA:11368773ProtMapper:22507872SIGNOR:11368773HPRD:11368773ProtMapper:23758320 |
| LAT | ZAP70 | P43403 | Y | 127 | phosphorylation | HPRDPhosphoSiteKEA | HPRD:11368773KEA:11368773 |
| LAT | ZAP70 | P43403 | Y | 132 | phosphorylation | HPRDPhosphoSiteKEA | HPRD:11368773KEA:11368773 |
Page 1 of 6Next
Ligand-Receptor Signaling
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
Page 1 of 2Next
Regulatory Interaction Network
23 records.
Page 1 of 3Next
Protein Complex Composition
67 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LATS1LATS2MOB1AMOB1BSTK38LSTK4 | O95835Q13043Q7L9L4Q9H8S9Q9NRM7Q9Y2H1 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7651 | ||
| LATS1LATS2MOB1BRASSF4SAV1STK3 | O95835Q13188Q7L9L4Q9H2L5Q9H4B6Q9NRM7 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5770 | ||
| LATS1LATS2MOB1AMOB1BMOB2STK38L | O95835Q70IA6Q7L9L4Q9H8S9Q9NRM7Q9Y2H1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| LATS1LATS2MOB1B | O95835Q7L9L4Q9NRM7 | 0:0:0 | hu.MAP2 | |||
| LATS1MOB1A | O95835Q9H8S9 | 1:1 | PDB | PDB:5brk | ||
| ARF5LCLAT1MT-CO2RIDAUBCYTHDF2 | P00403P0CG48P52758P84085Q6UWP7Q9Y5A9 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6614 | ||
| PLAT | P00750 | 4 | PDB | PDB:1pmlPDB:1bdaPDB:1tpkPDB:1a5h | ||
| ANLNARHGAP35PLATSERPINB2 | P00750P05120Q9NQW6Q9NRY4 | 0:0:0:0 | hu.MAP2 | |||
| ARHGAP35PLATSERPINB2 | P00750P05120Q9NRY4 | 0:0:0 | hu.MAP2 | |||
| CDC73CTR9DLATDLDLEO1PAF1TCEA1 | P09622P10515P23193Q6P1J9Q6PD62Q8N7H5Q8WVC0 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7282 |
Sequence, Structure & Domains
Sequences
Length
262
Mass
27,930
Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759
Alternative Sequence
1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
243..253; Acidic residues
Region
69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1
Clinical Relevance
Drug Targets
Literature-reported target
Drugs
Interaction Protein
ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396
Interaction Count
5
Interaction Dataset
intact_biogrid