Protein detail

LAT

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Entry name LAT	UniProt ID O43561	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Basic Information

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class (6)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

Position

28984826-28990784

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization

Function & Pathway

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component (8)

Molecular Function (4)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (14)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence166

Enzyme-Mediated Modification (60)

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	MAPK3	P27361	T	155	phosphorylation	PhosphoSite
LAT	MAPK3	P27361	T	191	phosphorylation	MIMPPhosphoSite_MIMP
LAT	SYK	P43405	Y	161	phosphorylation	Li2012REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:24782869
LAT	SYK	P43405	Y	200	phosphorylation	Li2012Reactome_ProtMapperREACH_ProtMapperProtMapper	ProtMapper:24782869
LAT	SYK	P43405	Y	220	phosphorylation	Li2012Reactome_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:18068154
LAT	SYK	P43405	Y	255	phosphorylation	Li2012
LAT	PTK2B	Q14289	Y	171	phosphorylation	PhosphoSite
LAT	PTK2B	Q14289	Y	200	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:28699640
LAT	PTK2	Q05397	Y	171	phosphorylation	PhosphoSite
LAT	PTK2	Q05397	Y	200	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:29456532 ProtMapper:28699640

Page 4 of 6Previous Next

Ligand-Receptor Signaling (15)

15 records.

Category	Parent	Database	Plasma Membrane (Transmembrane)
transmembrane	transmembrane	OmniPath	Yes
plasma_membrane	plasma_membrane	UniProt_location	Yes
plasma_membrane	plasma_membrane	OmniPath	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	Yes

Page 2 of 2Previous

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTPRJ	Q12913	LAT	O43561	Yes		Yes	WangSIGNORDEPODHPRDSPIKE_LCSPIKE	DEPOD:11259588 HPRD:11259588 SPIKE:11259588 SIGNOR:11259588 SPIKE_LC:11259588
LAT	O43561	PLCG1	P19174	Yes	Yes		WangNetPathSIGNORLi2012HPRDCui2007HINTSignaLink3BioGRIDIntActLMPIDSPIKE_LCLit-BM-17SPIKETCRcuration_SignaLink3	HINT:27221712 Lit-BM-17:11368773 IntAct:16938345 SignaLink3:23109003 SignaLink3:15286727 HPRD:9729044 SPIKE_LC:16467851 IntAct:9489702 NetPath:10811803 SignaLink3:11709089 SPIKE:10811803 SPIKE:16467851 Lit-BM-17:9489702 HINT:10811803 LMPID:10811803 SIGNOR:11368773 HINT:9489702 SignaLink3:15219999 SPIKE_LC:10811803 HINT:16938345 HINT:15696170 IntAct:24642916 SPIKE_LC:16938345 IntAct:10811803 HINT:16467851 Lit-BM-17:10811803 HINT:11368773 LMPID:11368773 HINT:24642916 HPRD:11368773 SignaLink3:12941616 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:27221712 BioGRID:9729044 SPIKE:16938345 Lit-BM-17:16467851 SPIKE_LC:16713569 HPRD:16467851
LAT	O43561	VAV	P15498	Yes	Yes		WangNetPathSIGNORHPRDHINTSignaLink3Li2012SPIKE_LCSPIKETCRcuration_SignaLink3	SPIKE:16713569 SignaLink3:23109003 NetPath:12186560 HINT:12186560 SPIKE_LC:12186560 HINT:11368773 SPIKE:12186560 SPIKE_LC:16713569 HPRD:11368773 SignaLink3:12186560 SIGNOR:11368773
LAT	O43561	GAB2	Q9UQC2	Yes			WangNetPathHPRDSignaLink3SPIKE_LCSPIKETCRcuration_SignaLink3	HPRD:11572860 SignaLink3:23109003 SignaLink3:12640133 NetPath:11572860 SignaLink3:11572860 SPIKE_LC:11572860 SPIKE:11572860
LAT	O43561	GRB2	P62993	Yes	Yes		WangNetPathSIGNORLi2012HPRDCui2007HINTBioGRIDIntActDIPSPIKE_LCLit-BM-17SPIKE	Lit-BM-17:12186560 Lit-BM-17:11368773 IntAct:16938345 NetPath:12186560 HINT:12186560 SIGNOR:23150273 HINT:7510700 NetPath:17043143 SIGNOR:10811803 IntAct:9489702 DIP:16906159 Lit-BM-17:16906159 HPRD:16906159 Lit-BM-17:9489702 HINT:10811803 HINT:16906159 HPRD:9489702 BioGRID:8063801 HINT:8063801 HINT:9489702 HINT:16938345 SPIKE_LC:16938345 IntAct:10811803 SPIKE_LC:12186560 Lit-BM-17:10811803 SPIKE:12186560 SPIKE:16906159 HINT:7516467 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:8063801 SPIKE_LC:16906159 SPIKE:16938345 IntAct:16906159 SPIKE_LC:16713569
LAT	O43561	VAV3	Q9UKW4	Yes			SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:12186560
LAT	O43561		Q6FHA6	Yes			SignaLink3TCRcuration_SignaLink3	SignaLink3:10021361 SignaLink3:23109003 SignaLink3:15219999
ZAP70	P43403	LAT	O43561	Yes	Yes		HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEASignaLink3phosphoELM_KEAHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteTCRcuration_SignaLink3Sparser_ProtMapperSPIKE_LCHPRD-phos	KEA:15659558 ProtMapper:11368773 PhosphoSite:11395491 SignaLink3:23109003 PhosphoSite:27896837 HINT:12186560 SIGNOR:29915297 KEA:10811803 ProtMapper:27700984 PhosphoSite:12496416 PhosphoSite:30510001 ProtMapper:24119664 PhosphoSite:24642916 ProtMapper:31611699 ProtMapper:29915297 PhosphoSite:15100278 ProtMapper:23758320 SIGNOR:11368773 KEA:11368773 ProtMapper:35095913 ProtMapper:18779373 HPRD-phos:11368773 PhosphoSite:11368773 ProtMapper:22507872 ProtMapper:23150273 HINT:11368773 HPRD:11368773 PhosphoSite:33931484 SPIKE_LC:16906159 PhosphoSite:15029250 PhosphoSite:24412752 SignaLink3:15084594 PhosphoSite:34161759
LAT	O43561	3BP2	P78314	Yes			HPRDHINTSignaLink3TCRcuration_SignaLink3	HINT:9846481 SignaLink3:23109003 HPRD:11390470 SignaLink3:15751964 HINT:17306257
LAT	O43561	P85A	P27986	Yes	Yes		WangNetPathSIGNORHINTSignaLink3SPIKE_LCTCRcuration_SignaLink3	SignaLink3:19132916 NetPath:9489702 SignaLink3:23109003 SignaLink3:14696041 HINT:10811803 HINT:11368773 SPIKE_LC:16713569 HINT:7544353 SIGNOR:11368773

Page 1 of 3Next

Protein Complex Composition (67)

67 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
LATS1 LATS2 MOB1A MOB1B STK38L STK4	O95835 Q13043 Q7L9L4 Q9H8S9 Q9NRM7 Q9Y2H1	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7651
LATS1 LATS2 MOB1B RASSF4 SAV1 STK3	O95835 Q13188 Q7L9L4 Q9H2L5 Q9H4B6 Q9NRM7	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5770
LATS1 LATS2 MOB1A MOB1B MOB2 STK38L	O95835 Q70IA6 Q7L9L4 Q9H8S9 Q9NRM7 Q9Y2H1	0:0:0:0:0:0	hu.MAP2
LATS1 LATS2 MOB1B	O95835 Q7L9L4 Q9NRM7	0:0:0	hu.MAP2
LATS1 MOB1A	O95835 Q9H8S9	1:1	PDB	PDB:5brk
ARF5 LCLAT1 MT-CO2 RIDA UBC YTHDF2	P00403 P0CG48 P52758 P84085 Q6UWP7 Q9Y5A9	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6614
PLAT	P00750	4	PDB	PDB:1pmlPDB:1bdaPDB:1tpkPDB:1a5h
ANLN ARHGAP35 PLAT SERPINB2	P00750 P05120 Q9NQW6 Q9NRY4	0:0:0:0	hu.MAP2
ARHGAP35 PLAT SERPINB2	P00750 P05120 Q9NRY4	0:0:0	hu.MAP2
CDC73 CTR9 DLAT DLD LEO1 PAF1 TCEA1	P09622 P10515 P23193 Q6P1J9 Q6PD62 Q8N7H5 Q8WVC0	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7282

Page 6 of 7Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody (4)

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein (5)

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Related sentences
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No related sentences available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No related sentences available
36736734	Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus.	No related sentences available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No related sentences available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No related sentences available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No related sentences available