Protein detail
LAT
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Entry name LAT | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein Class (6)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Transmembrane
5..27; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
LAT1
Gene Description
Linker for activation of T cells
Chromosome
16
Position
28984826-28990784
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Function & Pathway
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
KEGG (11)
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05135 Yersinia infection
Page 1 of 2
Reactome (14)
- R-hsa-1280218 adaptive immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
Page 1 of 2
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence166
Enzyme-Mediated Modification (60)
60 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LAT | ZAP70 | P43403 | Y | 207 | phosphorylation | MIMPHPRDHPRD_MIMPPhosphoSite_MIMP | HPRD:11368773 |
| LAT | ZAP70 | P43403 | Y | 227 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRD | HPRD:11368773 |
| LAT | ZAP70 | P43403 | Y | 262 | phosphorylation | MIMPHPRDHPRD_MIMPPhosphoSite_MIMP | HPRD:11368773 |
| LAT | LCK | P06239 | Y | 220 | phosphorylation | SIGNOR_ProtMapperReactome_ProtMapperSIGNORProtMapper | ProtMapper:16938345SIGNOR:16938345 |
| LAT | LCK | P06239 | Y | 200 | phosphorylation | SIGNOR_ProtMapperReactome_ProtMapperSIGNORProtMapper | ProtMapper:16938345SIGNOR:16938345 |
| LAT | LCK | P06239 | Y | 156 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:27700984 |
| LAT | LCK | P06239 | Y | 64 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:27700984 |
| LAT | FYN | P06241 | Y | 220 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:16938345SIGNOR:16938345 |
| LAT | FYN | P06241 | Y | 200 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:16938345SIGNOR:16938345 |
| LAT | MAPK3 | P27361 | T | 184 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:15192708SIGNOR:15192708 |
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes |
Page 1 of 2Next
Regulatory Interaction Network (23)
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LAT | O43561 | P85B | O00459 | Yes | Yes | NetPathWangSIGNOR | NetPath:9489702SIGNOR:11368773 | |
| LCK | P06239 | LAT | O43561 | Yes | Yes | WangiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperReactome_ProtMapperSIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:16938345HPRD:12186560HPRD:12359715ProtMapper:27700984SIGNOR:16938345 | |
| FAK2 | Q14289 | LAT | O43561 | Yes | PhosphoSiteSparser_ProtMapperProtMapper | PhosphoSite:31189114ProtMapper:28699640PhosphoSite:28699640 |
Page 3 of 3Previous
Protein Complex Composition (67)
67 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LATS1LATS2MOB1AMOB1BSTK38LSTK4 | O95835Q13043Q7L9L4Q9H8S9Q9NRM7Q9Y2H1 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7651 | ||
| LATS1LATS2MOB1BRASSF4SAV1STK3 | O95835Q13188Q7L9L4Q9H2L5Q9H4B6Q9NRM7 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5770 | ||
| LATS1LATS2MOB1AMOB1BMOB2STK38L | O95835Q70IA6Q7L9L4Q9H8S9Q9NRM7Q9Y2H1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| LATS1LATS2MOB1B | O95835Q7L9L4Q9NRM7 | 0:0:0 | hu.MAP2 | |||
| LATS1MOB1A | O95835Q9H8S9 | 1:1 | PDB | PDB:5brk | ||
| ARF5LCLAT1MT-CO2RIDAUBCYTHDF2 | P00403P0CG48P52758P84085Q6UWP7Q9Y5A9 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6614 | ||
| PLAT | P00750 | 4 | PDB | PDB:1pmlPDB:1bdaPDB:1tpkPDB:1a5h | ||
| ANLNARHGAP35PLATSERPINB2 | P00750P05120Q9NQW6Q9NRY4 | 0:0:0:0 | hu.MAP2 | |||
| ARHGAP35PLATSERPINB2 | P00750P05120Q9NRY4 | 0:0:0 | hu.MAP2 | |||
| CDC73CTR9DLATDLDLEO1PAF1TCEA1 | P09622P10515P23193Q6P1J9Q6PD62Q8N7H5Q8WVC0 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7282 |
Sequence, Structure & Domains
Sequences
Length
262
Mass
27,930
Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759
Alternative Sequence
1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)
Domain & Motif Annotations
Compositional Bias
243..253; Acidic residues
Region
69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1
Clinical Relevance
Drug Targets
Literature-reported target
Drugs
Interaction Protein (5)
ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396
Interaction Count
5
Interaction Dataset
intact_biogrid
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No related sentences available |
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No related sentences available |
| 36736734 | Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |