EV MemProt Atlas

Basic Information13

Protein Names

Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)

Protein Class (6)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Transmembrane

5..27; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

1

Ensembl

ENSG00000213658

Entrez Gene Symbol

LAT

Gene Synonym

LAT1

Gene Description

Linker for activation of T cells

Chromosome

16

Position

28984826-28990784

Supporting publications (n)

6

EVMP confidence score

0.63

Fluorescence & Localization1

Function & Pathway7

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins
RAS pathway related proteins

Cellular Component (8)

Molecular Function (4)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (14)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence166

Enzyme-Mediated Modification (60)

60 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LAT	ZAP70	P43403	Y	207	phosphorylation	MIMPHPRDHPRD_MIMPPhosphoSite_MIMP	HPRD:11368773
LAT	ZAP70	P43403	Y	227	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRD	HPRD:11368773
LAT	ZAP70	P43403	Y	262	phosphorylation	MIMPHPRDHPRD_MIMPPhosphoSite_MIMP	HPRD:11368773
LAT	LCK	P06239	Y	220	phosphorylation	SIGNOR_ProtMapperReactome_ProtMapperSIGNORProtMapper	ProtMapper:16938345 SIGNOR:16938345
LAT	LCK	P06239	Y	200	phosphorylation	SIGNOR_ProtMapperReactome_ProtMapperSIGNORProtMapper	ProtMapper:16938345 SIGNOR:16938345
LAT	LCK	P06239	Y	156	phosphorylation	RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:27700984
LAT	LCK	P06239	Y	64	phosphorylation	RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:27700984
LAT	FYN	P06241	Y	220	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:16938345 SIGNOR:16938345
LAT	FYN	P06241	Y	200	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:16938345 SIGNOR:16938345
LAT	MAPK3	P27361	T	184	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:15192708 SIGNOR:15192708

Page 3 of 6Previous Next

Ligand-Receptor Signaling (15)

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No

Page 2 of 2Previous

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTPRJ	Q12913	LAT	O43561	Yes	No	Yes	WangSIGNORDEPODHPRDSPIKE_LCSPIKE	DEPOD:11259588 HPRD:11259588 SPIKE:11259588 SIGNOR:11259588 SPIKE_LC:11259588
LAT	O43561	PLCG1	P19174	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTSignaLink3BioGRIDIntActLMPIDSPIKE_LCLit-BM-17SPIKETCRcuration_SignaLink3	HINT:27221712 Lit-BM-17:11368773 IntAct:16938345 SignaLink3:23109003 SignaLink3:15286727 HPRD:9729044 SPIKE_LC:16467851 IntAct:9489702 NetPath:10811803 SignaLink3:11709089 SPIKE:10811803 SPIKE:16467851 Lit-BM-17:9489702 HINT:10811803 LMPID:10811803 SIGNOR:11368773 HINT:9489702 SignaLink3:15219999 SPIKE_LC:10811803 HINT:16938345 HINT:15696170 IntAct:24642916 SPIKE_LC:16938345 IntAct:10811803 HINT:16467851 Lit-BM-17:10811803 HINT:11368773 LMPID:11368773 HINT:24642916 HPRD:11368773 SignaLink3:12941616 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:27221712 BioGRID:9729044 SPIKE:16938345 Lit-BM-17:16467851 SPIKE_LC:16713569 HPRD:16467851
LAT	O43561	VAV	P15498	Yes	Yes	No	WangNetPathSIGNORHPRDHINTSignaLink3Li2012SPIKE_LCSPIKETCRcuration_SignaLink3	SPIKE:16713569 SignaLink3:23109003 NetPath:12186560 HINT:12186560 SPIKE_LC:12186560 HINT:11368773 SPIKE:12186560 SPIKE_LC:16713569 HPRD:11368773 SignaLink3:12186560 SIGNOR:11368773
LAT	O43561	GAB2	Q9UQC2	Yes	No	No	WangNetPathHPRDSignaLink3SPIKE_LCSPIKETCRcuration_SignaLink3	HPRD:11572860 SignaLink3:23109003 SignaLink3:12640133 NetPath:11572860 SignaLink3:11572860 SPIKE_LC:11572860 SPIKE:11572860
LAT	O43561	GRB2	P62993	Yes	Yes	No	WangNetPathSIGNORLi2012HPRDCui2007HINTBioGRIDIntActDIPSPIKE_LCLit-BM-17SPIKE	Lit-BM-17:12186560 Lit-BM-17:11368773 IntAct:16938345 NetPath:12186560 HINT:12186560 SIGNOR:23150273 HINT:7510700 NetPath:17043143 SIGNOR:10811803 IntAct:9489702 DIP:16906159 Lit-BM-17:16906159 HPRD:16906159 Lit-BM-17:9489702 HINT:10811803 HINT:16906159 HPRD:9489702 BioGRID:8063801 HINT:8063801 HINT:9489702 HINT:16938345 SPIKE_LC:16938345 IntAct:10811803 SPIKE_LC:12186560 Lit-BM-17:10811803 SPIKE:12186560 SPIKE:16906159 HINT:7516467 SPIKE:16713569 Lit-BM-17:16938345 Lit-BM-17:8063801 SPIKE_LC:16906159 SPIKE:16938345 IntAct:16906159 SPIKE_LC:16713569
LAT	O43561	VAV3	Q9UKW4	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:23109003 SignaLink3:12186560
LAT	O43561		Q6FHA6	Yes	No	No	SignaLink3TCRcuration_SignaLink3	SignaLink3:10021361 SignaLink3:23109003 SignaLink3:15219999
ZAP70	P43403	LAT	O43561	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTPhosphoSite_KEASignaLink3phosphoELM_KEAHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteTCRcuration_SignaLink3Sparser_ProtMapperSPIKE_LCHPRD-phos	KEA:15659558 ProtMapper:11368773 PhosphoSite:11395491 SignaLink3:23109003 PhosphoSite:27896837 HINT:12186560 SIGNOR:29915297 KEA:10811803 ProtMapper:27700984 PhosphoSite:12496416 PhosphoSite:30510001 ProtMapper:24119664 PhosphoSite:24642916 ProtMapper:31611699 ProtMapper:29915297 PhosphoSite:15100278 ProtMapper:23758320 SIGNOR:11368773 KEA:11368773 ProtMapper:35095913 ProtMapper:18779373 HPRD-phos:11368773 PhosphoSite:11368773 ProtMapper:22507872 ProtMapper:23150273 HINT:11368773 HPRD:11368773 PhosphoSite:33931484 SPIKE_LC:16906159 PhosphoSite:15029250 PhosphoSite:24412752 SignaLink3:15084594 PhosphoSite:34161759
LAT	O43561	3BP2	P78314	Yes	No	No	HPRDHINTSignaLink3TCRcuration_SignaLink3	HINT:9846481 SignaLink3:23109003 HPRD:11390470 SignaLink3:15751964 HINT:17306257
LAT	O43561	P85A	P27986	Yes	Yes	No	WangNetPathSIGNORHINTSignaLink3SPIKE_LCTCRcuration_SignaLink3	SignaLink3:19132916 NetPath:9489702 SignaLink3:23109003 SignaLink3:14696041 HINT:10811803 HINT:11368773 SPIKE_LC:16713569 HINT:7544353 SIGNOR:11368773

Page 1 of 3Next

Protein Complex Composition (67)

67 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster220	DLAT DLD LEO1	P09622 P10515 Q8WVC0	1:1:1	Compleat	Compleat:HC1015	22036573
HT_SC_Cluster123	BCKDHA DLAT PDHA1 PDHA2 PDHB PDHX	O00330 P08559 P10515 P11177 P12694 P29803	1:1:1:1:1:1	Compleat	Compleat:HC1502
LAT-GRB2 complexFyn-mLck(KA) or Syk kinase activated	GRB2 LAT	O43561 P62993	1:1	CompleatCORUM	Compleat:HC3195CORUM:2957	16938345
LATS1-HTRA2-BIRC4 complex	HTRA2 LATS1 XIAP	O43464 O95835 P98170	1:1:1	CompleatCORUM	Compleat:HC3229CORUM:5317	16007220
LATS1-NPHP4 complex	LATS1 NPHP4	O75161 O95835	0:0	CORUM	CORUM:6660	21555462
Lab-Grb2 complexBCR stimulated	GRB2 LAT2	P62993 Q9GZY6	1:1	Compleat	Compleat:HC802	12514734
Mitochondrial pyruvate dehydrogenase complexsomatic variant	DLAT DLD PDHA1 PDHB PDHX	O00330 P08559 P09622 P10515 P11177	1:1:1:1:1	ComplexPortal	PDB:3EXFPDB:3EXGPDB:1NI4PDB:6cerPDB:2OZLPDB:2f5zintact:EBI-26361944PDB:6cfoPDB:3EXIPDB:3EXEPDB:3EXHPDB:1ZY8	24534072 19240034 14755292 19081061 29608861
Mitochondrial pyruvate dehydrogenase complextestis-specific variant	DLAT DLD PDHA2 PDHB PDHX	O00330 P09622 P10515 P11177 P29803	1:1:1:1:1	ComplexPortal	PDB:2f5zintact:EBI-26364516PDB:1ZY8	16436377 24534072 19240034 14755292 19081061 29608861
PDH	DLAT DLD PDHA1 PDHA2 PDHB PDHX	O00330 P08559 P09622 P10515 P11177 P29803	0:0:0:0:0:0	SIGNOR	SIGNOR:SIGNOR-C402
PLC-gamma-2-LAT complex	LAT PLCG2	O43561 P16885	1:1	CompleatCORUM	Compleat:HC2253CORUM:2913	10469124

Page 1 of 7Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	31753726 29603567

Sequence, Structure & Domains7

Sequences

Length

262

Mass

27,930

Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759

Alternative Sequence

1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)

Domain & Motif Annotations

Compositional Bias

243..253; Acidic residues

Region

69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1

Clinical Relevance6

Drug Targets

Literature-reported target

Drugs

TRIDOLGOSIR

Antibody (4)

CAB002223 HPA011157 CAB012978 CAB079960

Interaction Protein (5)

ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396

Interaction Count

5

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Abstract
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
36736734	Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available

Entry name LAT	UniProt ID O43561	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins