Protein detail
LAT
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Entry name LAT | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein Class (6)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Transmembrane
5..27; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
LAT1
Gene Description
Linker for activation of T cells
Chromosome
16
Position
28984826-28990784
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Function & Pathway
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
KEGG (11)
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05135 Yersinia infection
Page 1 of 2
Reactome (14)
- R-hsa-1280218 adaptive immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
Page 1 of 2
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence166
Enzyme-Mediated Modification (60)
60 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LAT | MAPK3 | P27361 | T | 155 | phosphorylation | PhosphoSite | |
| LAT | MAPK3 | P27361 | T | 191 | phosphorylation | MIMPPhosphoSite_MIMP | |
| LAT | SYK | P43405 | Y | 161 | phosphorylation | Li2012REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24782869 |
| LAT | SYK | P43405 | Y | 200 | phosphorylation | Li2012Reactome_ProtMapperREACH_ProtMapperProtMapper | ProtMapper:24782869 |
| LAT | SYK | P43405 | Y | 220 | phosphorylation | Li2012Reactome_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:18068154 |
| LAT | SYK | P43405 | Y | 255 | phosphorylation | Li2012 | |
| LAT | PTK2B | Q14289 | Y | 171 | phosphorylation | PhosphoSite | |
| LAT | PTK2B | Q14289 | Y | 200 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:28699640 |
| LAT | PTK2 | Q05397 | Y | 171 | phosphorylation | PhosphoSite | |
| LAT | PTK2 | Q05397 | Y | 200 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:29456532ProtMapper:28699640 |
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes |
Page 1 of 2Next
Regulatory Interaction Network (23)
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LAT | O43561 | Q96EV4 | Yes | SignaLink3TCRcuration_SignaLink3 | SignaLink3:23109003SignaLink3:19132916SignaLink3:14696041 | |||
| MK08 | P45983 | LAT | O43561 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapper | ProtMapper:15192708SIGNOR:15192708 | |
| STK25 | O00506 | LAT | O43561 | Yes | Yes | SIGNOR | SIGNOR:30948712 | |
| STK4 | Q13043 | LAT | O43561 | Yes | Yes | SIGNOR | SIGNOR:26456820 | |
| TRAF6 | Q9Y4K3 | LAT | O43561 | Yes | Yes | SIGNORBioGRID | BioGRID:25907557SIGNOR:23514740 | |
| PTN1 | P18031 | LAT | O43561 | Yes | Yes | DOMINOWangSIGNORDEPODHPRDInnateDBSPIKE_LC | DOMINO:12857726SIGNOR:12857726SPIKE_LC:12857726DEPOD:12857726HPRD:12857726InnateDB:12857726 | |
| LAT | O43561 | COMPLEX:P27986_P42336 | Yes | Yes | SIGNOR | SIGNOR:11368773 | ||
| FYN | P06241 | LAT | O43561 | Yes | Yes | iPTMnetSIGNORProtMapperSIGNOR_ProtMapperWang | ProtMapper:16938345SIGNOR:16938345 | |
| LAT | O43561 | PK3CA | P42336 | Yes | Yes | WangSIGNOR | SIGNOR:11368773 | |
| MK03 | P27361 | LAT | O43561 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite | ProtMapper:15192708SIGNOR:15192708PhosphoSite:15192708 |
Protein Complex Composition (67)
67 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster220 | DLATDLDLEO1 | P09622P10515Q8WVC0 | 1:1:1 | Compleat | Compleat:HC1015 | 22036573 |
| HT_SC_Cluster123 | BCKDHADLATPDHA1PDHA2PDHBPDHX | O00330P08559P10515P11177P12694P29803 | 1:1:1:1:1:1 | Compleat | Compleat:HC1502 | |
| LAT-GRB2 complexFyn-mLck(KA) or Syk kinase activated | GRB2LAT | O43561P62993 | 1:1 | CompleatCORUM | Compleat:HC3195CORUM:2957 | 16938345 |
| LATS1-HTRA2-BIRC4 complex | HTRA2LATS1XIAP | O43464O95835P98170 | 1:1:1 | CompleatCORUM | Compleat:HC3229CORUM:5317 | 16007220 |
| LATS1-NPHP4 complex | LATS1NPHP4 | O75161O95835 | 0:0 | CORUM | CORUM:6660 | 21555462 |
| Lab-Grb2 complexBCR stimulated | GRB2LAT2 | P62993Q9GZY6 | 1:1 | Compleat | Compleat:HC802 | 12514734 |
| Mitochondrial pyruvate dehydrogenase complexsomatic variant | DLATDLDPDHA1PDHBPDHX | O00330P08559P09622P10515P11177 | 1:1:1:1:1 | ComplexPortal | PDB:3EXFPDB:3EXGPDB:1NI4PDB:6cerPDB:2OZLPDB:2f5zintact:EBI-26361944PDB:6cfoPDB:3EXIPDB:3EXEPDB:3EXHPDB:1ZY8 | 2453407219240034147552921908106129608861 |
| Mitochondrial pyruvate dehydrogenase complextestis-specific variant | DLATDLDPDHA2PDHBPDHX | O00330P09622P10515P11177P29803 | 1:1:1:1:1 | ComplexPortal | PDB:2f5zintact:EBI-26364516PDB:1ZY8 | 164363772453407219240034147552921908106129608861 |
| PDH | DLATDLDPDHA1PDHA2PDHBPDHX | O00330P08559P09622P10515P11177P29803 | 0:0:0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C402 | |
| PLC-gamma-2-LAT complex | LATPLCG2 | O43561P16885 | 1:1 | CompleatCORUM | Compleat:HC2253CORUM:2913 | 10469124 |
Page 1 of 7Next
Sequence, Structure & Domains
Sequences
Length
262
Mass
27,930
Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759
Alternative Sequence
1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)
Domain & Motif Annotations
Compositional Bias
243..253; Acidic residues
Region
69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1
Clinical Relevance
Drug Targets
Literature-reported target
Drugs
Interaction Protein (5)
ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396
Interaction Count
5
Interaction Dataset
intact_biogrid
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No related sentences available |
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No related sentences available |
| 36736734 | Extracellular vesicle proteomics and phosphoproteomics identify pathways for increased risk in patients hospitalized with COVID-19 and type 2 diabetes mellitus. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |