Protein detail
LAT
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein symbol LAT | UniProt ID | EVMP score 0.63 |
Frequency 6 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins |
Basic Information
Protein Names
Linker for activation of T-cells family member 1 (36 kDa phosphotyrosine adapter protein) (pp36) (p36-38)
Protein Class
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Transmembrane
5..27; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
LAT1
Gene Description
Linker for activation of T cells
Chromosome
16
Position
28984826-28990784
Frequency
6
EVMP Score
0.63
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-202403 tcr signaling
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
60 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LAT | ITK | Q08881 | Y | 70 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 161 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 220 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 255 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 110 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 200 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 36 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 45 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 156 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
| LAT | ITK | Q08881 | Y | 64 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:12186560ProtMapper:11368773ProtMapper:9489702 |
Ligand-Receptor Signaling
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
Page 1 of 2Next
Regulatory Interaction Network
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LAT | O43561 | P85B | O00459 | Yes | Yes | No | NetPathWangSIGNOR | NetPath:9489702SIGNOR:11368773 |
| LCK | P06239 | LAT | O43561 | Yes | Yes | No | WangiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperReactome_ProtMapperSIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:16938345HPRD:12186560HPRD:12359715ProtMapper:27700984SIGNOR:16938345 |
| FAK2 | Q14289 | LAT | O43561 | Yes | No | No | PhosphoSiteSparser_ProtMapperProtMapper | PhosphoSite:31189114ProtMapper:28699640PhosphoSite:28699640 |
Page 3 of 3Previous
Protein Complex Composition
67 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster220 | DLATDLDLEO1 | P09622P10515Q8WVC0 | 1:1:1 | Compleat | Compleat:HC1015 | 22036573 |
| HT_SC_Cluster123 | BCKDHADLATPDHA1PDHA2PDHBPDHX | O00330P08559P10515P11177P12694P29803 | 1:1:1:1:1:1 | Compleat | Compleat:HC1502 | |
| LAT-GRB2 complexFyn-mLck(KA) or Syk kinase activated | GRB2LAT | O43561P62993 | 1:1 | CompleatCORUM | Compleat:HC3195CORUM:2957 | 16938345 |
| LATS1-HTRA2-BIRC4 complex | HTRA2LATS1XIAP | O43464O95835P98170 | 1:1:1 | CompleatCORUM | Compleat:HC3229CORUM:5317 | 16007220 |
| LATS1-NPHP4 complex | LATS1NPHP4 | O75161O95835 | 0:0 | CORUM | CORUM:6660 | 21555462 |
| Lab-Grb2 complexBCR stimulated | GRB2LAT2 | P62993Q9GZY6 | 1:1 | Compleat | Compleat:HC802 | 12514734 |
| Mitochondrial pyruvate dehydrogenase complexsomatic variant | DLATDLDPDHA1PDHBPDHX | O00330P08559P09622P10515P11177 | 1:1:1:1:1 | ComplexPortal | PDB:3EXFPDB:3EXGPDB:1NI4PDB:6cerPDB:2OZLPDB:2f5zintact:EBI-26361944PDB:6cfoPDB:3EXIPDB:3EXEPDB:3EXHPDB:1ZY8 | 2453407219240034147552921908106129608861 |
| Mitochondrial pyruvate dehydrogenase complextestis-specific variant | DLATDLDPDHA2PDHBPDHX | O00330P09622P10515P11177P29803 | 1:1:1:1:1 | ComplexPortal | PDB:2f5zintact:EBI-26364516PDB:1ZY8 | 164363772453407219240034147552921908106129608861 |
| PDH | DLATDLDPDHA1PDHA2PDHBPDHX | O00330P08559P09622P10515P11177P29803 | 0:0:0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C402 | |
| PLC-gamma-2-LAT complex | LATPLCG2 | O43561P16885 | 1:1 | CompleatCORUM | Compleat:HC2253CORUM:2913 | 10469124 |
Page 1 of 7Next
Sequence, Structure & Domains
Sequences
Length
262
Mass
27,930
Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Long; IsoId=O43561-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=O43561-2; Sequence=VSP_004303; Name=3; IsoId=O43561-3; Sequence=VSP_054758, VSP_004303; Name=4; IsoId=O43561-4; Sequence=VSP_054759, VSP_004303; Name=5; IsoId=O43561-5; Sequence=VSP_054759
Alternative Sequence
1; M -> MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM (in isoform 3); 83; Missing (in isoform 4 and isoform 5); 114..142; Missing (in isoform 2, isoform 3 and isoform 4)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
243..253; Acidic residues
Region
69..115; Disordered; 161..164; Interaction with PLCG1; 200..203; Interaction with GRB2, GRAP2 and PIK3R1; 206..262; Disordered; 220..223; Interaction with GRB2, GRAP2 and PIK3R1
Clinical Relevance
Drug Targets
Literature-reported target
Drugs
Interaction Protein
ENSG00000124181ENSG00000146648ENSG00000177885ENSG00000182866ENSG00000196396
Interaction Count
5
Interaction Dataset
intact_biogrid