Protein detail
CAH12
Carbonic anhydrase 12 (EC 4.2.1.1) (Carbonate dehydratase XII) (Carbonic anhydrase XII) (CA-XII) (Tumor antigen HOM-RCC-3.1.3)
Entry name CAH12 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Carbonic anhydrase 12 (EC 4.2.1.1) (Carbonate dehydratase XII) (Carbonic anhydrase XII) (CA-XII) (Tumor antigen HOM-RCC-3.1.3)
Protein Class (6)
Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteins
Protein Function (5)
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- ENZYME proteins:Lyases
- Enzymes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
302..322; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HsT18816
Gene Description
Carbonic anhydrase 12
Chromosome
15
Position
63321378-63381846
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization4
Cell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificendothelial cellSecretome LocationSecreted to bloodSecretome FunctionImmunity
Function & Pathway7
Protein Function (5)
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- ENZYME proteins:Lyases
- Enzymes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence33
Ligand-Receptor Signaling (31)
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_surface_enzyme | cell_surface_enzyme | Surfaceome | Yes | No | No | Yes | No |
| cell_surface_enzyme | cell_surface_enzyme | OmniPath | Yes | No | No | Yes | No |
Page 1 of 4Next
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CA12 | O43570 | 2 | PDB | PDB:9fn7PDB:5llpPDB:4qjoPDB:9f2nPDB:5ll5PDB:6t5qPDB:6qngPDB:4ht2PDB:9f30PDB:5ll9PDB:6qn0PDB:4qj0PDB:6g5lPDB:1jczPDB:5lloPDB:6rpsPDB:7puwPDB:6r6yPDB:6g7aPDB:4ww8PDB:9f2oPDB:1jd0PDB:7pp9PDB:6r71PDB:8co3PDB:5msaPDB:4kp5PDB:5msbPDB:4kp8PDB:9f3gPDB:6qnlPDB:4qjwPDB:6t5pPDB:9fn8PDB:4q0lPDB:7puuPDB:7puv |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains12
Sequences
Length
354
Mass
39,451
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O43570-1; Sequence=Displayed; Name=2; IsoId=O43570-2; Sequence=VSP_000772
Alternative Sequence
292..302; Missing (in isoform 2)
3D Structural Models
Turn
151..153; 213..216
Helix
36..38; 40..45; 48..51; 62..64; 157..160; 181..187; 188..192; 207..210; 247..255
Beta Strand
52..54; 65..67; 75..78; 85..91; 93..99; 105..111; 113..122; 132..135; 141..150; 167..176; 199..203; 218..223; 234..241; 243..245; 258..260; 285..288
3D Structure
X-ray crystallography (37)
Domain & Motif Annotations
Domain (FT)
30..289; Alpha-carbonic anhydrase
Protein Families
Alpha-carbonic anhydrase family
Sequence Similarities
Belongs to the alpha-carbonic anhydrase family.
Clinical Relevance4
Disease Involvement (2)
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (14)
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |