Protein detail
TYOBP
TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)
Entry name TYOBP | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Transporters:Accessory Factors Involved in Transport
- Potential drug targets
Transmembrane
41..61; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
DAP12KARAPPLO-SLPLOSL
Gene Description
Transmembrane immune signaling adaptor TYROBP
Chromosome
19
Position
35904401-35908295
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificplacentaCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Transporters:Accessory Factors Involved in Transport
- Potential drug targets
Cellular Component
Molecular Function
Biological Process
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-1500931 cell cell communication
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-168249 innate immune system
- R-hsa-9675108 nervous system development
- R-hsa-6798695 neutrophil degranulation
- R-hsa-416700 other semaphorin interactions
- R-hsa-373755 semaphorin interactions
- R-hsa-391160 signal regulatory protein family interactions
Canonical Pathways
- M7 Pid fcer1 pathway
- M10 Pid bcr 5pathway
Mediation Categories
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TYROBP | SYK | P43405 | Y | 90 | phosphorylation | HPRDKEA | KEA:9490415HPRD:9490415 |
| TYROBP | SYK | P43405 | Y | 101 | phosphorylation | HPRDKEA | KEA:9490415HPRD:9490415 |
| TYROBP | SYK | P43405 | Y | 91 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEAphosphoELMLi2012 | KEA:9490415HPRD:9490415phosphoELM:9490415 |
| TYROBP | SYK | P43405 | Y | 102 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEAphosphoELMLi2012 | KEA:9490415HPRD:9490415phosphoELM:9490415 |
| TYROBP | LCK | P06239 | Y | 91 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
Page 1 of 4Next
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CLM7 | A8K4G0 | TYOBP | O43914 | Yes | Yes | No | InnateDBSIGNOR | InnateDB:16920917SIGNOR:20959446 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
Sequence, Structure & Domains
Sequences
Length
113
Mass
12,179
Sequence
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=KARAP-a; IsoId=O43914-1; Sequence=Displayed; Name=2; Synonyms=KARAP-b; IsoId=O43914-2; Sequence=VSP_012909; Name=3; IsoId=O43914-3; Sequence=VSP_046066
Alternative Sequence
20..30; Missing (in isoform 3); 77; Missing (in isoform 2)
3D Structural Models
Helix
40..65
3D Structure
NMR spectroscopy (2); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
87..113; Polar residues
Domain (FT)
80..108; ITAM
Region
75..113; Disordered
Protein Families
TYROBP family
Sequence Similarities
Belongs to the TYROBP family.