Protein detail

TYOBP

TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)

Entry name TYOBP	UniProt ID O43914	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)

Protein Class (5)

Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters

Protein Function (4)

Disease related genes
Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
Transporters:Accessory Factors Involved in Transport
Potential drug targets

Transmembrane

41..61; Helical

Transmembrane Count

Ensembl

ENSG00000011600

Entrez Gene Symbol

TYROBP

Gene Synonym (4)

DAP12KARAPPLO-SLPLOSL

Gene Description

Transmembrane immune signaling adaptor TYROBP

Chromosome

Position

35904401-35908295

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue SpecificplacentaCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway8

Protein Function (4)

Disease related genes
Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
Transporters:Accessory Factors Involved in Transport
Potential drug targets

Cellular Component (4)

Molecular Function (7)

Biological Process (3)

KEGG (2)

Reactome (11)

Page 1 of 2

Canonical Pathways (2)

M7 Pid fcer1 pathway
M10 Pid bcr 5pathway

Mediation Categories (4)

Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence40

Enzyme-Mediated Modification (5)

5 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
TYROBP	SYK	P43405	Y	90	phosphorylation	HPRDKEA	KEA:9490415 HPRD:9490415
TYROBP	SYK	P43405	Y	101	phosphorylation	HPRDKEA	KEA:9490415 HPRD:9490415
TYROBP	SYK	P43405	Y	91	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEAphosphoELMLi2012	KEA:9490415 HPRD:9490415 phosphoELM:9490415
TYROBP	SYK	P43405	Y	102	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEAphosphoELMLi2012	KEA:9490415 HPRD:9490415 phosphoELM:9490415
TYROBP	LCK	P06239	Y	91	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (31)

31 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CLM7	A8K4G0	TYOBP	O43914	Yes	Yes	No	InnateDBSIGNOR	InnateDB:16920917 SIGNOR:20959446

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
DAP12 signaling homodimer complex	TYROBP	O43914	2	CORUMPDB	PDB:4wolPDB:4wo1CORUM:1957PDB:2l34	15845448
TREM2_receptor	TREM2 TYROBP	O43914 Q9NZC2	1:1	CellPhoneDBCellChatDB	CellPhoneDB:TREM2_receptor

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	12	36406491 34681663 38225453 38731868 24505114 30550287 39104279 40098346 38698420 37922300 40311616 31588238

Sequence, Structure & Domains12

Sequences

Length

113

Mass

12,179

Sequence

MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=KARAP-a; IsoId=O43914-1; Sequence=Displayed; Name=2; Synonyms=KARAP-b; IsoId=O43914-2; Sequence=VSP_012909; Name=3; IsoId=O43914-3; Sequence=VSP_046066

Alternative Sequence

20..30; Missing (in isoform 3); 77; Missing (in isoform 2)

3D Structural Models

Helix

40..65

3D Structure

NMR spectroscopy (2); X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

87..113; Polar residues

Domain (FT)

80..108; ITAM

Region

75..113; Disordered

Protein Families

TYROBP family

Sequence Similarities

Belongs to the TYROBP family.

Clinical Relevance4

Antibody (2)

CAB009493 HPA041899

Interaction Protein

ENSG00000101307

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available