Protein detail
MYPT2
Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2)
Entry name MYPT2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
MGC131980MGC87886MYPT2PP1bp55
Gene Description
Protein phosphatase 1 regulatory subunit 12B
Chromosome
1
Position
202348699-202592706
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue Specificbone marrowCell SpecificKupffer cellsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (5)
Biological Process (3)
KEGG (5)
Reactome (10)
- R-hsa-1640170 cell cycle
- R-hsa-69278 cell cycle mitotic
- R-hsa-453274 mitotic g2 g2 m phases
- R-hsa-2565942 regulation of plk1 activity at g2 m transition
- R-hsa-5625900 rho gtpases activate cit
- R-hsa-5627123 rho gtpases activate paks
- R-hsa-5625740 rho gtpases activate pkns
- R-hsa-5627117 rho gtpases activate rocks
- R-hsa-195258 rho gtpase effectors
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
Mediation Categories
Receptor-signaling mediation
Relations & Evidence12
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PPP1R12B | ROCK1 | Q13464 | T | 646 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:22937917SIGNOR:22937917 |
| PPP1R12B | ROCK2 | O75116 | T | 646 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22937917 |
| PPP1R12B | INS | P01308 | S | 504 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:22937917 |
| PPP1R12B | INS | P01308 | S | 29 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22937917 |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ROCK1 | Q13464 | MYPT2 | O60237 | Yes | No | Yes | WangPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperCui2007SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:22937917SIGNOR:22937917PhosphoSite:22937917PhosphoSite:16431080 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 30915084 |
Sequence, Structure & Domains8
Sequences
Length
982
Mass
110,404
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFSSGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISALLDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNEIPQTIAPSTYVSTYLKRTPHKSQADTTAEKTADNVSSSTPLCVITNRPLPSTANGVTATPVLSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSETTTNTTTAKEMDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKLEKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTELKSDNQRLKDENGALIRVISKLSK
Alternative Products
Event=Alternative promoter usage, Alternative splicing; Named isoforms=6; Name=1; IsoId=O60237-1; Sequence=Displayed; Name=2; IsoId=O60237-2; Sequence=VSP_009257, VSP_009258; Name=3; Synonyms=hHS-M21B, Heart-specific myosin light chain phosphatase small subunit B; IsoId=O60237-3; Sequence=VSP_009256, VSP_009259; Name=4; Synonyms=hHS-M21A, Heart-specific myosin light chain phosphatase small subunit A; IsoId=O60237-4; Sequence=VSP_009256; Name=5; IsoId=O60237-5; Sequence=VSP_043159, VSP_043160; Name=6; IsoId=O60237-6; Sequence=VSP_059344
Alternative Sequence
1..774; Missing (in isoform 3 and isoform 4); 381..386; DKKPEA -> VLFWPF (in isoform 2); 387..982; Missing (in isoform 2); 487..515; ERENKSYISSLAPRKLNSTSDIEEKENRE -> VQFGRVWGNSKAVFFFHENSILGTNENIF (in isoform 5); 516..982; Missing (in isoform 5); 555; K -> KSASFGRSSDPTSPYISANRNSSPATSPITIGSSTSRGSQWQPASSCPAPISANTTASVHHG (in isoform 6); 955..982; VLTELKSDNQRLKDENGALIRVISKLSK -> NLHQLKQIQTLKQMNEQLQAENRALTRVVARLSESIESSDTQEL (in isoform 3)
Domain & Motif Annotations
Compositional Bias
1..24; Basic and acidic residues; 362..374; Acidic residues; 375..385; Basic and acidic residues; 389..401; Polar residues; 411..421; Low complexity; 466..478; Low complexity; 482..491; Basic and acidic residues; 623..632; Basic and acidic residues; 633..643; Basic residues; 656..680; Basic and acidic residues; 731..742; Low complexity; 743..755; Polar residues; 797..807; Basic residues; 824..836; Basic and acidic residues; 840..849; Polar residues; 850..864; Basic and acidic residues; 918..927; Basic and acidic residues; 933..948; Basic and acidic residues
Repeat
57..86; ANK 1; 90..119; ANK 2; 123..152; ANK 3; 216..245; ANK 4; 249..278; ANK 5
Region
1..50; Disordered; 342..517; Disordered; 556..579; Disordered; 606..864; Disordered; 918..948; Disordered
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 36573687 | Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes. | No abstract available |