Protein detail

MYPT2

Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2)

Protein symbol MYPT2	UniProt ID O60237	EVMP score 0.38
Frequency 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2)

Protein Class

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000077157

Entrez Gene Symbol

PPP1R12B

Gene Synonym

MGC131980MGC87886MYPT2PP1bp55

Gene Description

Protein phosphatase 1 regulatory subunit 12B

Chromosome

Position

202348699-202592706

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificbone marrowCell SpecificKupffer cellsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1R12B	ROCK1	Q13464	T	646	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:22937917 SIGNOR:22937917
PPP1R12B	ROCK2	O75116	T	646	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:22937917
PPP1R12B	INS	P01308	S	504	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:22937917
PPP1R12B	INS	P01308	S	29	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:22937917

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ROCK1	Q13464	MYPT2	O60237	Yes	No	Yes	WangPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperCui2007SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:22937917 SIGNOR:22937917 PhosphoSite:22937917 PhosphoSite:16431080

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	MYLK PPP1R12B	O60237 Q15746	0:0	hu.MAP

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	1	30915084

Sequence, Structure & Domains

Sequences

Length

982

Mass

110,404

Sequence

MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFSSGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISALLDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNEIPQTIAPSTYVSTYLKRTPHKSQADTTAEKTADNVSSSTPLCVITNRPLPSTANGVTATPVLSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSETTTNTTTAKEMDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKLEKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTELKSDNQRLKDENGALIRVISKLSK

Alternative Products

Event=Alternative promoter usage, Alternative splicing; Named isoforms=6; Name=1; IsoId=O60237-1; Sequence=Displayed; Name=2; IsoId=O60237-2; Sequence=VSP_009257, VSP_009258; Name=3; Synonyms=hHS-M21B, Heart-specific myosin light chain phosphatase small subunit B; IsoId=O60237-3; Sequence=VSP_009256, VSP_009259; Name=4; Synonyms=hHS-M21A, Heart-specific myosin light chain phosphatase small subunit A; IsoId=O60237-4; Sequence=VSP_009256; Name=5; IsoId=O60237-5; Sequence=VSP_043159, VSP_043160; Name=6; IsoId=O60237-6; Sequence=VSP_059344

Alternative Sequence

1..774; Missing (in isoform 3 and isoform 4); 381..386; DKKPEA -> VLFWPF (in isoform 2); 387..982; Missing (in isoform 2); 487..515; ERENKSYISSLAPRKLNSTSDIEEKENRE -> VQFGRVWGNSKAVFFFHENSILGTNENIF (in isoform 5); 516..982; Missing (in isoform 5); 555; K -> KSASFGRSSDPTSPYISANRNSSPATSPITIGSSTSRGSQWQPASSCPAPISANTTASVHHG (in isoform 6); 955..982; VLTELKSDNQRLKDENGALIRVISKLSK -> NLHQLKQIQTLKQMNEQLQAENRALTRVVARLSESIESSDTQEL (in isoform 3)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

1..24; Basic and acidic residues; 362..374; Acidic residues; 375..385; Basic and acidic residues; 389..401; Polar residues; 411..421; Low complexity; 466..478; Low complexity; 482..491; Basic and acidic residues; 623..632; Basic and acidic residues; 633..643; Basic residues; 656..680; Basic and acidic residues; 731..742; Low complexity; 743..755; Polar residues; 797..807; Basic residues; 824..836; Basic and acidic residues; 840..849; Polar residues; 850..864; Basic and acidic residues; 918..927; Basic and acidic residues; 933..948; Basic and acidic residues

Repeat

57..86; ANK 1; 90..119; ANK 2; 123..152; ANK 3; 216..245; ANK 4; 249..278; ANK 5

Region

1..50; Disordered; 342..517; Disordered; 556..579; Disordered; 606..864; Disordered; 918..948; Disordered

Clinical Relevance

Antibody

HPA024171 HPA024640