Protein detail

FZD6

Frizzled-6 (Fz-6) (hFz6)

Entry name FZD6	UniProt ID O60353	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count 7	Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Frizzled-6 (Fz-6) (hFz6)

Protein Class (5)

Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

Protein Function (5)

Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes
G-protein coupled receptors:Family fz/smo receptors

Transmembrane

202..222; Helical; Name=1; 234..254; Helical; Name=2; 285..305; Helical; Name=3; 325..345; Helical; Name=4; 371..391; Helical; Name=5; 417..437; Helical; Name=6; 474..494; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000164930

Entrez Gene Symbol

FZD6

Gene Synonym

Hfz6

Gene Description

Frizzled class receptor 6

Chromosome

Position

103298433-103332866

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue SpecificbrainCell SpecificBrain excitatory neurons

Function & Pathway7

Protein Function (5)

Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes
G-protein coupled receptors:Family fz/smo receptors

Cellular Component (6)

Molecular Function (5)

Biological Process (3)

KEGG (16)

Page 1 of 2

Reactome (12)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence76

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
FZD6	CSNK1E	P49674	S	648	phosphorylation	PhosphoSite
FZD6	GRK5	P34947	S	648	phosphorylation	PhosphoSite
FZD6	GRK2	P25098	S	648	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (62)

62 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	LRdb	No	Yes	No	Yes	No
receptor	receptor	Baccin2019	No	Yes	No	Yes	No
gpcr	receptor	UniProt_keyword	No	Yes	No	Yes	No
cytokine	receptor	Baccin2019	No	Yes	No	Yes	No
seven_transmembrane_7tm	receptor	HPMR	No	Yes	No	Yes	No
frizzled_&_smoothened	receptor	HPMR	No	Yes	No	Yes	No
gpcr	receptor	Surfaceome	No	Yes	No	Yes	No
frizzled	receptor	Surfaceome	No	Yes	No	Yes	No
class_f_frizzled	receptor	GPCRdb	No	Yes	No	Yes	No
class_f_frizzled_protein	receptor	GPCRdb	No	Yes	No	Yes	No

Page 2 of 7Previous Next

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
WNT5A	P41221	FZD6	O60353	Yes	Yes	No	iTALKGuide2Pharma_LRdbSIGNORCellPhoneDB_CellinkerCellChatDBtalklrscConnectRamilowski2015_Baccin2019WangGuide2Pharma_CellinkerRamilowski2015Guide2Pharma_talklrBaccin2019CellinkerEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbconnectomeDB2020LRdb	connectomeDB2020:21665003 SIGNOR:16273260 Baccin2019:21665003 scConnect:21665003 Guide2Pharma:21665003 Cellinker:21665003 LRdb:21665003
WNT11	O96014	FZD6	O60353	Yes	Yes	No	CellChatDBWangSIGNORCellCall	SIGNOR:16273260
WNT1	P04628	FZD6	O60353	Yes	Yes	No	WangSIGNOR	SIGNOR:22944199
ZNRF3	Q9ULT6	FZD6	O60353	Yes	No	Yes	KEGG-MEDICUSSIGNOR	SIGNOR:22575959
FZD6	O60353	DVL1	O14640	Yes	Yes	No	WangSIGNOR	SIGNOR:22944199
WNT5B	Q9H1J7	FZD6	O60353	Yes	Yes	No	CellChatDBWangSIGNORCellCall	SIGNOR:16273260
ARBK1	P25098	FZD6	O60353	Yes	No	No	PhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:30309985

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
FZD6 GOLIM4 KIF5C SYNE4 ZFPL1	O00461 O60282 O60353 O95159 Q8N205	0:0:0:0:0	hu.MAP2
FZD6 GOLIM4 SYNE4 ZFPL1	O00461 O60353 O95159 Q8N205	0:0:0:0	hu.MAP2
FZD3 FZD6 KLC3 SYNE4 ZFPL1	O60353 O95159 Q6P597 Q8N205 Q9NPG1	0:0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyMicrofluidics-Based Methods	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	5	31753726 41167904 29603567 30865381 36028467

Sequence, Structure & Domains16

Sequences

Length

706

Mass

79,292

Sequence

MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O60353-1; Sequence=Displayed; Name=2; IsoId=O60353-2; Sequence=VSP_044291

Alternative Sequence

1..32; Missing (in isoform 2)

3D Structural Models

Turn

211..213; 280..282; 342..346; 453..456; 489..493

Helix

175..177; 193..210; 214..223; 229..232; 233..254; 283..311; 317..321; 324..331; 334..341; 365..370; 372..394; 411..439; 442..452; 473..485; 486..488

Beta Strand

163..165; 178..180; 184..186; 225..227; 256..261; 265..268; 275..279; 352..355; 358..362; 402..404

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Compositional Bias

646..658; Basic and acidic residues; 662..672; Polar residues; 673..685; Low complexity; 694..706; Basic and acidic residues

Motif

498..503; Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members

Domain (CC)

Lys-Thr-X-X-X-Trp motif interacts with the PDZ domain of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.; DOMAIN: The FZ domain is involved in binding with Wnt ligands.

Domain (FT)

19..132; FZ

Region

588..706; Disordered

Protein Families

G-protein coupled receptor Fz/Smo family

Sequence Similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Clinical Relevance3

Disease Involvement

Disease variant

Drugs (4)

SAG1.3 WNT-4 WNT-3A WNT-5A

Antibody

HPA017991

Supporting Publications5

PMID	Title	Abstract
21630462	Proteomic analysis of microvesicles derived from human colorectal cancer ascites.	No abstract available
26378940	Redefining the Breast Cancer Exosome Proteome by Tandem Mass Tag Quantitative Proteomics and Multivariate Cluster Analysis.	No abstract available
27863537	High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources.	No abstract available
29045505	Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients.	Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers.
32944193	Extracellular vesicles from human iPSC-derived neural stem cells: miRNA and protein signatures, and anti-inflammatory and neurogenic properties.	No abstract available