Protein detail
FZD6
Frizzled-6 (Fz-6) (hFz6)
Protein symbol FZD6 | UniProt ID | EVMP score 0.50 |
Frequency 5 | Transmembrane count 7 | Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins |
Basic Information
Protein Names
Frizzled-6 (Fz-6) (hFz6)
Protein Class
Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins
Protein Function
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- G-protein coupled receptors:Family fz/smo receptors
Transmembrane
202..222; Helical; Name=1; 234..254; Helical; Name=2; 285..305; Helical; Name=3; 325..345; Helical; Name=4; 371..391; Helical; Name=5; 417..437; Helical; Name=6; 474..494; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
Hfz6
Gene Description
Frizzled class receptor 6
Chromosome
8
Position
103298433-103332866
Frequency
5
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neurons
Function & Pathway
Protein Function
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- G-protein coupled receptors:Family fz/smo receptors
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04150 mTOR signaling pathway
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04390 Hippo signaling pathway
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04934 Cushing syndrome
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05217 Basal cell carcinoma
- KEGG:hsa05224 Breast cancer
- KEGG:hsa05225 Hepatocellular carcinoma
- KEGG:hsa05226 Gastric cancer
Reactome
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-500792 gpcr ligand binding
- R-hsa-4086400 pcp ce pathway
- R-hsa-4641263 regulation of fzd by ubiquitination
- R-hsa-372790 signaling by gpcr
- R-hsa-5340588 signaling by rnf43 mutants
- R-hsa-195721 signaling by wnt
- R-hsa-4791275 signaling by wnt in cancer
- R-hsa-201681 tcf dependent signaling in response to wnt
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
Ligand-Receptor Signaling
62 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | talklr | No | Yes | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| receptor | receptor | connectomeDB2020 | No | Yes | No | Yes | No |
| receptor | receptor | CellCall | No | Yes | No | Yes | No |
| receptor | receptor | iTALK | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| receptor | receptor | EMBRACE | No | Yes | No | Yes | No |
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| frizzled | receptor | HGNC | No | Yes | No | Yes | No |
Regulatory Interaction Network
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| WNT5A | P41221 | FZD6 | O60353 | Yes | Yes | No | iTALKGuide2Pharma_LRdbSIGNORCellPhoneDB_CellinkerCellChatDBtalklrscConnectRamilowski2015_Baccin2019WangGuide2Pharma_CellinkerRamilowski2015Guide2Pharma_talklrBaccin2019CellinkerEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbconnectomeDB2020LRdb | connectomeDB2020:21665003SIGNOR:16273260Baccin2019:21665003scConnect:21665003Guide2Pharma:21665003Cellinker:21665003LRdb:21665003 |
| WNT11 | O96014 | FZD6 | O60353 | Yes | Yes | No | CellChatDBWangSIGNORCellCall | SIGNOR:16273260 |
| WNT1 | P04628 | FZD6 | O60353 | Yes | Yes | No | WangSIGNOR | SIGNOR:22944199 |
| ZNRF3 | Q9ULT6 | FZD6 | O60353 | Yes | No | Yes | KEGG-MEDICUSSIGNOR | SIGNOR:22575959 |
| FZD6 | O60353 | DVL1 | O14640 | Yes | Yes | No | WangSIGNOR | SIGNOR:22944199 |
| WNT5B | Q9H1J7 | FZD6 | O60353 | Yes | Yes | No | CellChatDBWangSIGNORCellCall | SIGNOR:16273260 |
| ARBK1 | P25098 | FZD6 | O60353 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:30309985 |
Protein Complex Composition
3 records.
Sequence, Structure & Domains
Sequences
Length
706
Mass
79,292
Sequence
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O60353-1; Sequence=Displayed; Name=2; IsoId=O60353-2; Sequence=VSP_044291
Alternative Sequence
1..32; Missing (in isoform 2)
3D Structural Models
Turn
211..213; 280..282; 342..346; 453..456; 489..493
Helix
175..177; 193..210; 214..223; 229..232; 233..254; 283..311; 317..321; 324..331; 334..341; 365..370; 372..394; 411..439; 442..452; 473..485; 486..488
Beta Strand
163..165; 178..180; 184..186; 225..227; 256..261; 265..268; 275..279; 352..355; 358..362; 402..404
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Compositional Bias
646..658; Basic and acidic residues; 662..672; Polar residues; 673..685; Low complexity; 694..706; Basic and acidic residues
Motif
498..503; Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members
Domain (CC)
Lys-Thr-X-X-X-Trp motif interacts with the PDZ domain of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.; DOMAIN: The FZ domain is involved in binding with Wnt ligands.
Domain (FT)
19..132; FZ
Region
588..706; Disordered
Protein Families
G-protein coupled receptor Fz/Smo family
Sequence Similarities
Belongs to the G-protein coupled receptor Fz/Smo family.