Protein detail
FZD6
Frizzled-6 (Fz-6) (hFz6)
Entry name FZD6 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 5 | Transmembrane count 7 | Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Frizzled-6 (Fz-6) (hFz6)
Protein Class (5)
Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins
Protein Function (5)
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- G-protein coupled receptors:Family fz/smo receptors
Transmembrane
202..222; Helical; Name=1; 234..254; Helical; Name=2; 285..305; Helical; Name=3; 325..345; Helical; Name=4; 371..391; Helical; Name=5; 417..437; Helical; Name=6; 474..494; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
Hfz6
Gene Description
Frizzled class receptor 6
Chromosome
8
Position
103298433-103332866
Supporting publications (n)
5
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neurons
Function & Pathway
Protein Function (5)
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- G-protein coupled receptors:Family fz/smo receptors
Cellular Component (6)
Molecular Function (5)
Biological Process (3)
KEGG (16)
- hsa04150 mTOR signaling pathway
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04390 Hippo signaling pathway
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04934 Cushing syndrome
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05165 Human papillomavirus infection
Page 1 of 2
Reactome (12)
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-500792 gpcr ligand binding
- R-hsa-4086400 pcp ce pathway
- R-hsa-4641263 regulation of fzd by ubiquitination
- R-hsa-372790 signaling by gpcr
- R-hsa-5340588 signaling by rnf43 mutants
- R-hsa-195721 signaling by wnt
Page 1 of 2
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence76
Enzyme-Mediated Modification (3)
Ligand-Receptor Signaling (62)
62 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | talklr | Yes | Yes | |||
| receptor | receptor | Cellinker | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | connectomeDB2020 | Yes | Yes | |||
| receptor | receptor | CellCall | Yes | Yes | |||
| receptor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| receptor | receptor | EMBRACE | Yes | Yes | |||
| gpcr | receptor | GPCRdb | Yes | Yes | |||
| frizzled | receptor | HGNC | Yes | Yes |
Regulatory Interaction Network (7)
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| WNT5A | P41221 | FZD6 | O60353 | Yes | Yes | iTALKGuide2Pharma_LRdbSIGNORCellPhoneDB_CellinkerCellChatDBtalklrscConnectRamilowski2015_Baccin2019WangGuide2Pharma_CellinkerRamilowski2015Guide2Pharma_talklrBaccin2019CellinkerEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbconnectomeDB2020LRdb | connectomeDB2020:21665003SIGNOR:16273260Baccin2019:21665003scConnect:21665003Guide2Pharma:21665003Cellinker:21665003LRdb:21665003 | |
| WNT11 | O96014 | FZD6 | O60353 | Yes | Yes | CellChatDBWangSIGNORCellCall | SIGNOR:16273260 | |
| WNT1 | P04628 | FZD6 | O60353 | Yes | Yes | WangSIGNOR | SIGNOR:22944199 | |
| ZNRF3 | Q9ULT6 | FZD6 | O60353 | Yes | Yes | KEGG-MEDICUSSIGNOR | SIGNOR:22575959 | |
| FZD6 | O60353 | DVL1 | O14640 | Yes | Yes | WangSIGNOR | SIGNOR:22944199 | |
| WNT5B | Q9H1J7 | FZD6 | O60353 | Yes | Yes | CellChatDBWangSIGNORCellCall | SIGNOR:16273260 | |
| ARBK1 | P25098 | FZD6 | O60353 | Yes | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:30309985 |
Protein Complex Composition (3)
3 records.
Sequence, Structure & Domains
Sequences
Length
706
Mass
79,292
Sequence
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O60353-1; Sequence=Displayed; Name=2; IsoId=O60353-2; Sequence=VSP_044291
Alternative Sequence
1..32; Missing (in isoform 2)
3D Structural Models
Turn
211..213; 280..282; 342..346; 453..456; 489..493
Helix
175..177; 193..210; 214..223; 229..232; 233..254; 283..311; 317..321; 324..331; 334..341; 365..370; 372..394; 411..439; 442..452; 473..485; 486..488
Beta Strand
163..165; 178..180; 184..186; 225..227; 256..261; 265..268; 275..279; 352..355; 358..362; 402..404
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Compositional Bias
646..658; Basic and acidic residues; 662..672; Polar residues; 673..685; Low complexity; 694..706; Basic and acidic residues
Motif
498..503; Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members
Domain (CC)
Lys-Thr-X-X-X-Trp motif interacts with the PDZ domain of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.; DOMAIN: The FZ domain is involved in binding with Wnt ligands.
Domain (FT)
19..132; FZ
Region
588..706; Disordered
Protein Families
G-protein coupled receptor Fz/Smo family
Sequence Similarities
Belongs to the G-protein coupled receptor Fz/Smo family.
Clinical Relevance
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 21630462 | Proteomic analysis of microvesicles derived from human colorectal cancer ascites. | No related sentences available |
| 26378940 | Redefining the Breast Cancer Exosome Proteome by Tandem Mass Tag Quantitative Proteomics and Multivariate Cluster Analysis. | No related sentences available |
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No related sentences available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 32944193 | Extracellular vesicles from human iPSC-derived neural stem cells: miRNA and protein signatures, and anti-inflammatory and neurogenic properties. | No related sentences available |