Protein detail
ABCC9
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Protein symbol ABCC9 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 15 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Protein Class
Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Transmembrane
31..51; Helical; Name=1; 73..93; Helical; Name=2; 102..122; Helical; Name=3; 133..153; Helical; Name=4; 168..188; Helical; Name=5; 302..322; Helical; Name=6; 351..371; Helical; Name=7; 424..444; Helical; Name=8; 456..476; Helical; Name=9; 532..552; Helical; Name=10; 572..592; Helical; Name=11; 991..1011; Helical; Name=12; 1035..1055; Helical; Name=13; 1128..1148; Helical; Name=14; 1246..1266; Helical; Name=15
Transmembrane Count
15
Ensembl
Entrez Gene Symbol
Gene Synonym
CMD1OSUR2
Gene Description
ATP binding cassette subfamily C member 9
Chromosome
12
Position
21797389-21942543
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificEndometrial glandular cellsBlood Cell Specificplasmacytoid DC
Function & Pathway
Protein Function
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Cellular Component
Molecular Function
- GO:0005267 potassium channel activity
- GO:0005524 ATP binding
- GO:0008281 sulfonylurea receptor activity
- GO:0015272 ATP-activated inward rectifier potassium channel activity
- GO:0015459 potassium channel regulator activity
- GO:0016887 ATP hydrolysis activity
- GO:0019829 ATPase-coupled monoatomic cation transmembrane transporter activity
- GO:0042626 ATPase-coupled transmembrane transporter activity
- GO:0043225 ATPase-coupled inorganic anion transmembrane transporter activity
- GO:0044325 transmembrane transporter binding
- GO:0044877 protein-containing complex binding
- GO:0099104 potassium channel activator activity
- GO:0140359 ABC-type transporter activity
Biological Process
Reactome
- R-hsa-382556 abc family proteins mediated transport
- R-hsa-5619084 abc transporter disorders
- R-hsa-5576891 cardiac conduction
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-1296065 inwardly rectifying k channels
- R-hsa-5578775 ion homeostasis
- R-hsa-397014 muscle contraction
- R-hsa-112316 neuronal system
- R-hsa-1296071 potassium channels
- R-hsa-382551 transport of small molecules
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transporter | transporter | Surfaceome | No | Yes | No | No | No |
| abcc | transporter | HGNC | No | Yes | No | No | No |
| transporter | transporter | HGNC | No | Yes | No | No | No |
| abc | transporter | DGIdb | No | Yes | No | No | No |
| transporter | transporter | DGIdb | No | Yes | No | No | No |
Page 1 of 3Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| KATP channel | ABCC8ABCC9KCNJ11KCNJ8 | O60706Q09428Q14654Q15842 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C274 | |
| KCNJ11-ABCC9 complex | ABCC9KCNJ11 | O60706Q14654 | 1:1 | CORUMComplexPortal | CORUM:6654intact:EBI-10954853intact:EBI-10954742 | 983170825236767200860791475529218079561190795619382894 |
| ABCC9ATP13A1CYP26C1FA2HGOLT1BKCNJ11REEP3SACM1LSURF4TMED10TMED2TMED7TMED9UBCURGCP | O15260O60706P0CG48P49755Q14654Q15363Q6NUK4Q6V0L0Q7L5A8Q8TCY9Q9BVK6Q9HD20Q9NTJ5Q9Y3B3Q9Y3E0 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7240 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31805958 |
Sequence, Structure & Domains
Sequences
Length
1,549
Mass
174,223
Sequence
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIVYYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLLMAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHKKPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLSSTFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFLALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIETNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEAQKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAIISVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQRYKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTSEYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALLPLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITNYLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=SUR2A; IsoId=O60706-1; Sequence=Displayed; Name=SUR2B; IsoId=O60706-2; Sequence=VSP_000058
Alternative Sequence
1508..1549; SSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK -> HTILTADLVIVMKRGNILEYDTPESLLAQENGVFASFVRADM (in isoform SUR2B)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
951..966; Acidic residues
Domain (FT)
297..597; ABC transmembrane type-1 1; 672..912; ABC transporter 1; 994..1274; ABC transmembrane type-1 2; 1312..1546; ABC transporter 2
Region
944..967; Disordered
Protein Families
- ABC transporter superfamily
- ABCC family
- Conjugate transporter (TC 3.A.1.208) subfamily
Sequence Similarities
Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
Clinical Relevance
Disease Involvement
Atrial fibrillationCardiomyopathyDisease variantFDA approved drug targetsIntellectual disability
Biomarker
Approved; Discontinued in Phase 1
Drug Targets
FDA approved drug targets
Drugs
Antibody