Protein detail
ABCC9
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Entry name ABCC9 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 15 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Protein Class (6)
Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Transmembrane
31..51; Helical; Name=1; 73..93; Helical; Name=2; 102..122; Helical; Name=3; 133..153; Helical; Name=4; 168..188; Helical; Name=5; 302..322; Helical; Name=6; 351..371; Helical; Name=7; 424..444; Helical; Name=8; 456..476; Helical; Name=9; 532..552; Helical; Name=10; 572..592; Helical; Name=11; 991..1011; Helical; Name=12; 1035..1055; Helical; Name=13; 1128..1148; Helical; Name=14; 1246..1266; Helical; Name=15
Transmembrane Count
15
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CMD1OSUR2
Gene Description
ATP binding cassette subfamily C member 9
Chromosome
12
Position
21797389-21942543
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificEndometrial glandular cellsBlood Cell Specificplasmacytoid DC
Function & Pathway7
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Transporters:Primary Active Transporters
- FDA approved drug targets:Small molecule drugs
Cellular Component (7)
Molecular Function (13)
- GO:0005267 potassium channel activity
- GO:0005524 ATP binding
- GO:0008281 sulfonylurea receptor activity
- GO:0015272 ATP-activated inward rectifier potassium channel activity
- GO:0015459 potassium channel regulator activity
- GO:0016887 ATP hydrolysis activity
- GO:0019829 ATPase-coupled monoatomic cation transmembrane transporter activity
- GO:0042626 ATPase-coupled transmembrane transporter activity
- GO:0043225 ATPase-coupled inorganic anion transmembrane transporter activity
- GO:0044325 transmembrane transporter binding
Page 1 of 2
Biological Process (3)
Reactome (10)
- R-hsa-382556 abc family proteins mediated transport
- R-hsa-5619084 abc transporter disorders
- R-hsa-5576891 cardiac conduction
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-1296065 inwardly rectifying k channels
- R-hsa-5578775 ion homeostasis
- R-hsa-397014 muscle contraction
- R-hsa-112316 neuronal system
- R-hsa-1296071 potassium channels
- R-hsa-382551 transport of small molecules
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence30
Ligand-Receptor Signaling (26)
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 3 of 3Previous
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| KATP channel | ABCC8ABCC9KCNJ11KCNJ8 | O60706Q09428Q14654Q15842 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C274 | |
| KCNJ11-ABCC9 complex | ABCC9KCNJ11 | O60706Q14654 | 1:1 | CORUMComplexPortal | CORUM:6654intact:EBI-10954853intact:EBI-10954742 | 983170825236767200860791475529218079561190795619382894 |
| ABCC9ATP13A1CYP26C1FA2HGOLT1BKCNJ11REEP3SACM1LSURF4TMED10TMED2TMED7TMED9UBCURGCP | O15260O60706P0CG48P49755Q14654Q15363Q6NUK4Q6V0L0Q7L5A8Q8TCY9Q9BVK6Q9HD20Q9NTJ5Q9Y3B3Q9Y3E0 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7240 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31805958 |
Sequence, Structure & Domains10
Sequences
Length
1,549
Mass
174,223
Sequence
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIVYYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLLMAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHKKPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLSSTFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFLALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIETNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEAQKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAIISVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQRYKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTSEYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALLPLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITNYLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=SUR2A; IsoId=O60706-1; Sequence=Displayed; Name=SUR2B; IsoId=O60706-2; Sequence=VSP_000058
Alternative Sequence
1508..1549; SSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK -> HTILTADLVIVMKRGNILEYDTPESLLAQENGVFASFVRADM (in isoform SUR2B)
Domain & Motif Annotations
Compositional Bias
951..966; Acidic residues
Domain (FT)
297..597; ABC transmembrane type-1 1; 672..912; ABC transporter 1; 994..1274; ABC transmembrane type-1 2; 1312..1546; ABC transporter 2
Region
944..967; Disordered
Protein Families (3)
- ABC transporter superfamily
- ABCC family
- Conjugate transporter (TC 3.A.1.208) subfamily
Sequence Similarities
Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
Clinical Relevance6
Disease Involvement (5)
Atrial fibrillationCardiomyopathyDisease variantFDA approved drug targetsIntellectual disability
Related Diseases (4)
Biomarker
Approved; Discontinued in Phase 1
Drug Targets
FDA approved drug targets
Drugs (11)
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 39363010 | Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons. | No abstract available |