Protein detail
PLPL9
85/88 kDa calcium-independent phospholipase A2 (CaI-PLA2) (EC 3.1.1.4) (2-lysophosphatidylcholine acylhydrolase) (EC 3.1.1.5) (Group VI phospholipase A2) (GVI PLA2) (Intracellular membrane-associated calcium-independent phospholipase A2 beta) (iPLA2-beta) (Palmitoyl-CoA hydrolase) (EC 3.1.2.2) (Patatin-like phospholipase domain-containing protein 9) (PNPLA9)
Entry name PLPL9 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 2 | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
85/88 kDa calcium-independent phospholipase A2 (CaI-PLA2) (EC 3.1.1.4) (2-lysophosphatidylcholine acylhydrolase) (EC 3.1.1.5) (Group VI phospholipase A2) (GVI PLA2) (Intracellular membrane-associated calcium-independent phospholipase A2 beta) (iPLA2-beta) (Palmitoyl-CoA hydrolase) (EC 3.1.2.2) (Patatin-like phospholipase domain-containing protein 9) (PNPLA9)
Protein Class
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteins
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Transmembrane
480..500; Helical; 511..531; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym
iPLA2iPLA2betaNBIA2PARK14PNPLA9
Gene Description
Phospholipase A2 group VI
Chromosome
22
Position
38111495-38214778
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component
Molecular Function
- GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
- GO:0004622 lysophospholipase activity
- GO:0004623 phospholipase A2 activity
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0016787 hydrolase activity
- GO:0017171 serine hydrolase activity
- GO:0042802 identical protein binding
- GO:0047499 calcium-independent phospholipase A2 activity
- GO:0052816 long-chain fatty acyl-CoA hydrolase activity
Biological Process
KEGG
- hsa00564 Glycerophospholipid metabolism
- KEGG:hsa00565 Ether lipid metabolism
- KEGG:hsa00590 Arachidonic acid metabolism
- KEGG:hsa00591 Linoleic acid metabolism
- KEGG:hsa00592 alpha-Linolenic acid metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04148 Efferocytosis
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
Reactome
- R-hsa-1482798 acyl chain remodeling of cl
- R-hsa-1482788 acyl chain remodelling of pc
- R-hsa-1482839 acyl chain remodelling of pe
- R-hsa-6811436 copi independent golgi to er retrograde traffic
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-1483206 glycerophospholipid biosynthesis
- R-hsa-8856688 golgi to er retrograde transport
- R-hsa-168249 innate immune system
- R-hsa-6811442 intra golgi and retrograde golgi to er traffic
- R-hsa-199991 membrane trafficking
- R-hsa-556833 metabolism of lipids
- R-hsa-1483257 phospholipid metabolism
- R-hsa-2029485 role of phospholipids in phagocytosis
- R-hsa-5653656 vesicle mediated transport
Mediation Categories
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
806
Mass
89,903
Sequence
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=LH-iPLA2; IsoId=O60733-1; Sequence=Displayed; Name=SH-iPLA2; IsoId=O60733-2; Sequence=VSP_000278; Name=Ankyrin-iPLA2-1; IsoId=O60733-3; Sequence=VSP_000281, VSP_000282; Name=Ankyrin-iPLA2-2; IsoId=O60733-4; Sequence=VSP_000277, VSP_000279, VSP_000280
Alternative Sequence
71..142; Missing (in isoform Ankyrin-iPLA2-2); 396..450; LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE -> Q (in isoform SH-iPLA2); 450..499; ELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKGLIIIQLLIA -> GSHPSQAGWWAWGAVSDGTTGSHAHLTGPEASVHPGLHEGREADMQNLSP (in isoform Ankyrin-iPLA2-2); 477..479; HDH -> CRT (in isoform Ankyrin-iPLA2-1); 480..806; Missing (in isoform Ankyrin-iPLA2-1); 500..806; Missing (in isoform Ankyrin-iPLA2-2)
3D Structural Models
Domain & Motif Annotations
Repeat
120..147; ANK 1; 151..181; ANK 1; 185..215; ANK 2; 219..248; ANK 3; 251..281; ANK 4; 286..312; ANK 5; 316..345; ANK 6; 349..378; ANK 7; 382..403; ANK 9
Motif
485..490; GXGXXG; 517..521; GXSXG; 652..654; DGA/G
Domain (CC)
Has two putative calmodulin binding domains, the 1-9-14 and IQ motifs. One calmodulin molecule interacts with PLA2G6 dimer, likely through 1-9-14 motif on each monomer (By similarity). Binds calmodulin in a calcium-dependent way (By similarity).
Domain (FT)
481..665; PNPLA
Region
677..686; Calmodulin-binding (1-9-14 motif); 748..759; Calmodulin-binding (IQ motif)
Clinical Relevance
Disease Involvement
Disease variantDystoniaNeurodegenerationParkinson diseaseParkinsonism