Protein detail
SCN2B
Sodium channel regulatory subunit beta-2
Entry name SCN2B | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Sodium channel regulatory subunit beta-2
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- FDA approved drug targets:Small molecule drugs
- Transporters:Accessory Factors Involved in Transport
Transmembrane
158..179; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization3
Cell SpecificBreast lactating cellsBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway7
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- FDA approved drug targets:Small molecule drugs
- Transporters:Accessory Factors Involved in Transport
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (8)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence43
Ligand-Receptor Signaling (37)
37 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transporter | transporter | Surfaceome | No | Yes | No | Yes | No |
| auxiliary_transport_unit | transporter | Almen2009 | No | Yes | No | Yes | No |
| sodiumchannelbeta | transporter | Surfaceome | No | Yes | No | Yes | No |
Page 1 of 4Next
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Nav1.3 voltage-gated sodium channel complexSCN1B-SCN2B variant | SCN1BSCN2BSCN3A | O60939Q07699Q9NY46 | 1:1:1 | ComplexPortalPDB | PDB:7W7FPDB:7W77PDB:7w77PDB:7w7fintact:EBI-48430485 | 1868823522992729337125472247378314755292 |
| Nav1.4 voltage-gated sodium channel complexSCN1B-SCN2B variant | SCN1BSCN2BSCN4A | O60939P35499Q07699 | 1:1:1 | ComplexPortal | intact:EBI-48430676PDB:6AGF | 1868823522992729224737831475529230190309 |
| Nav1.8 voltage-gated sodium channel complexSCN1B-SCN2B variant | SCN10ASCN1BSCN2B | O60939Q07699Q9Y5Y9 | 1:1:1 | ComplexPortal | intact:EBI-48431636 | 224737831475529222992729 |
| Nav1.9 voltage-gated sodium channel complexSCN1B-SCN2B variant | SCN11ASCN1BSCN2B | O60939Q07699Q9UI33 | 1:1:1 | ComplexPortal | intact:EBI-48431796 | 224737831475529222992729 |
| SCN2B | O60939 | 2 | PDB | PDB:5fdy |
Isolation & Detection Technology (1)
Sequence, Structure & Domains12
Sequences
Length
215
Mass
24,326
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
3D Structural Models
Turn
60..62; 96..98
Helix
93..95; 105..107; 119..121
Beta Strand
31..33; 36..41; 46..48; 51..53; 64..72; 73..75; 77..89; 99..101; 112..114; 123..130; 134..137; 138..147
3D Structure
Electron microscopy (30); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
189..215; Basic and acidic residues
Domain (FT)
32..154; Ig-like C2-type
Region
187..215; Disordered
Protein Families
Sodium channel auxiliary subunit SCN2B (TC 8.A.17) family
Sequence Similarities
Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
Clinical Relevance1
Drugs
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No abstract available |