Protein detail
FCG3B
Low affinity immunoglobulin gamma Fc region receptor III-B (Fc-gamma RIII-beta) (CD16-I) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)
Entry name FCG3B | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Low affinity immunoglobulin gamma Fc region receptor III-B (Fc-gamma RIII-beta) (CD16-I) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- FDA approved drug targets:Biotech drugs
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization5
Tissue Specificblood vesselCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal dentate gyrusSecretome LocationSecreted to bloodSecretome FunctionDevelopmental protein
Function & Pathway8
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- FDA approved drug targets:Biotech drugs
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
KEGG (9)
- hsa04145 Phagosome
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05150 Staphylococcus aureus infection
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05322 Systemic lupus erythematosus
Reactome (4)
Canonical Pathways (3)
- M278 Pid rac1 pathway
- M81 Pid cdc42 pathway
- M164 Pid erbb1 downstream pathway
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence43
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | Yes | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | OmniPath | No | No | Yes | Yes | Yes |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38207106 |
Sequence, Structure & Domains7
Sequences
Length
233
Mass
26,243
Sequence
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
3D Structural Models
Helix
81..83; 131..133; 164..166
Beta Strand
27..32; 35..38; 43..48; 59..62; 65..70; 72..78; 85..90; 92..94; 100..105; 107..112; 116..119; 120..122; 124..130; 137..143; 146..153; 157..161; 168..176; 179..182; 186..191
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Domain (FT)
40..96; Ig-like C2-type 1; 121..179; Ig-like C2-type 2
Clinical Relevance1
Drugs (33)
PUROMYCINMETHOTREXATEIL-18PENICILLINFAS LIGANDTETRADECANOYLPHORBOL ACETATECHOLECALCIFEROLEPOETIN ALFAPROTEASE INHIBITORSODIUM CHLORIDECYCLOSPORINEPROGESTINPICIBANILDOXORUBICIN HYDROCHLORIDECYTARABINEALDESLEUKINRECOMBINANT INTERLEUKIN-8BETA-GLUCANCHONDROITIN SULFATESLACTULOSEMAFOSFAMIDEPOLY ICTHALIDOMIDEIMMUNOTHERAPEUTIC AGENTPREDNISOLONEINDOMETHACINDIMETHYL SULFOXIDEGELDANAMYCINMETHIMAZOLELIFANGIOGENESIS INHIBITORHEPARINFENTANYL CITRATE
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |