Protein detail
KI21B
Kinesin-like protein KIF21B
Entry name KI21B | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Kinesin-like protein KIF21B
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
DKFZP434J212KIAA0449
Gene Description
Kinesin family member 21B
Chromosome
1
Position
200969390-201023714
Supporting publications (n)
1
EVMP confidence score
0.38
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (5)
Reactome (8)
- R-hsa-6811434 copi dependent golgi to er retrograde traffic
- R-hsa-983231 factors involved in megakaryocyte development and platelet production
- R-hsa-8856688 golgi to er retrograde transport
- R-hsa-109582 hemostasis
- R-hsa-6811442 intra golgi and retrograde golgi to er traffic
- R-hsa-983189 kinesins
- R-hsa-199991 membrane trafficking
- R-hsa-5653656 vesicle mediated transport
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence7
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TRI31 | Q9BZY9 | KI21B | O75037 | Yes | Yes | No | SIGNOR | SIGNOR:24086586 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa) | 1 | 40326690 |
Sequence, Structure & Domains12
Sequences
Length
1,637
Mass
182,662
Sequence
MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHLFGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDANGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCTQPDLVNEAVTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYSDLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGDGNEAIGALIQNYIREIEELRTKLLESEAMNESLRRSLSRASARSPYSLGASPAAPAFGGSPASSMEDASEVIRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQQENSEETDENEAEEEEEERDESGCEEEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRKRERLQAESPEEEKGLQELAEEIEVLAANIDYINDGITDCQATIVQLEETKEELDSTDTSVVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLDALREKAEAHPELQALIYNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSEPKLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLPTRGSTFPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIISPVGGAKGARTAPLQCVSMAEGHTKPILCLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWELSRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGTIGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFIPGRPMLLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSDCRVKLWNYVPGLTPCLPRRVLAIKGRATTLP
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O75037-1; Sequence=Displayed; Name=2; IsoId=O75037-2; Sequence=VSP_016217; Name=3; IsoId=O75037-3; Sequence=VSP_016217, VSP_045333; Name=4; IsoId=O75037-4; Sequence=VSP_045333
Alternative Sequence
1269..1281; Missing (in isoform 2 and isoform 3); 1607..1636; CRVKLWNYVPGLTPCLPRRVLAIKGRATTL -> LTVKFWSVRRLPHSGP (in isoform 3 and isoform 4)
Domain & Motif Annotations
Compositional Bias
509..533; Low complexity; 578..627; Acidic residues; 846..865; Low complexity; 1194..1217; Polar residues
Repeat
1306..1343; WD 1; 1346..1384; WD 2; 1410..1448; WD 3; 1451..1493; WD 4; 1502..1539; WD 5; 1543..1582; WD 6; 1585..1622; WD 7
Coiled Coil
376..604; 631..824; 928..1016
Domain (FT)
8..370; Kinesin motor
Region
400..1099; Interaction with TRIM3; 509..538; Disordered; 552..628; Disordered; 830..865; Disordered; 880..906; Disordered; 1194..1251; Disordered
Protein Families (2)
- TRAFAC class myosin-kinesin ATPase superfamily
- Kinesin family
Sequence Similarities
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 39195200 | Analysis of Cytotoxic Granules and Constitutively Produced Extracellular Vesicles from Large Granular Lymphocytic Leukemia Cell Lines. | No abstract available |