Protein detail
AUXI
Auxilin (EC 3.1.3.-) (DnaJ homolog subfamily C member 6)
Entry name AUXI | UniProt ID | EVMP score 0.38 |
Frequency 3 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Auxilin (EC 3.1.3.-) (DnaJ homolog subfamily C member 6)
Protein Class
Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteins
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
KIAA0473PARK19
Gene Description
DnaJ heat shock protein family (Hsp40) member C6
Chromosome
1
Position
65248219-65415871
Frequency
3
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificvascular associated smooth muscle cell
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component
Molecular Function
Biological Process
Reactome
Canonical Pathways
- M23 Pid wnt noncanonical pathway
- M16801 Sig regulation of the actin cytoskeleton by rho gtpases
- M34 Pid tcr pathway
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DNAJC6 | LRRK2 | Q5S007 | S | 570 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AUXI | O75061 | HSP7C | P11142 | Yes | Yes | No | SIGNOR | SIGNOR:24789820 |
| LRRK2 | Q5S007 | AUXI | O75061 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:29735704 |
Protein Complex Composition
Isolation & Detection Technology
0 records.
Sequence, Structure & Domains
Sequences
Length
913
Mass
99,997
Sequence
MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O75061-1; Sequence=Displayed; Name=2; IsoId=O75061-2; Sequence=VSP_019580; Name=3; IsoId=O75061-3; Sequence=VSP_019579, VSP_019581; Name=4; IsoId=O75061-4; Sequence=VSP_019579
Alternative Sequence
1..13; Missing (in isoform 3 and isoform 4); 1..7; MKDSENK -> MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS (in isoform 2); 456..913; Missing (in isoform 3)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
506..523; Polar residues; 554..572; Low complexity; 599..629; Polar residues; 654..669; Low complexity
Repeat
36..39; 1; 40..43; 2; 44..47; 3
Motif
409..417; SH3-binding
Domain (CC)
The J domain mediates interaction with HSPA8/HSC70 and is required for basket dissociation.
Domain (FT)
55..222; Phosphatase tensin-type; 228..366; C2 tensin-type; 849..913; J
Region
36..47; 3 X 4 AA approximate tandem repeats; 451..776; Disordered