Protein detail

AUXI

Auxilin (EC 3.1.3.-) (DnaJ homolog subfamily C member 6)

Entry name AUXI	UniProt ID O75061	EVMP confidence score 0.38
Supporting publications (n) 3	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Auxilin (EC 3.1.3.-) (DnaJ homolog subfamily C member 6)

Protein Class (5)

Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteins

Protein Function (6)

Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Potential drug targets
Enzymes
ENZYME proteins:Hydrolases
Disease related genes

Ensembl

ENSG00000116675

Entrez Gene Symbol

DNAJC6

Gene Synonym (2)

KIAA0473PARK19

Gene Description

DnaJ heat shock protein family (Hsp40) member C6

Chromosome

Position

65248219-65415871

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Tissue Specificblood vesselCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificvascular associated smooth muscle cell

Function & Pathway8

Protein Function (6)

Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Potential drug targets
Enzymes
ENZYME proteins:Hydrolases
Disease related genes

Cellular Component (7)

Molecular Function (6)

Biological Process (3)

KEGG

hsa04144 Endocytosis

Reactome (6)

Canonical Pathways (3)

M23 Pid wnt noncanonical pathway
M16801 Sig regulation of the actin cytoskeleton by rho gtpases
M34 Pid tcr pathway

Mediation Categories (2)

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence11

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DNAJC6	LRRK2	Q5S007	S	570	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	LOCATE	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
AUXI	O75061	HSP7C	P11142	Yes	Yes	No	SIGNOR	SIGNOR:24789820
LRRK2	Q5S007	AUXI	O75061	Yes	No	No	PhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:29735704

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	DNAJC6 GNAT1	O75061 P11488	0:0	hu.MAP2
	DNAJC6 GNAT1 IL1RL2	O75061 P11488 Q9HB29	0:0:0	hu.MAP2

Sequence, Structure & Domains11

Sequences

Length

913

Mass

99,997

Sequence

MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O75061-1; Sequence=Displayed; Name=2; IsoId=O75061-2; Sequence=VSP_019580; Name=3; IsoId=O75061-3; Sequence=VSP_019579, VSP_019581; Name=4; IsoId=O75061-4; Sequence=VSP_019579

Alternative Sequence

1..13; Missing (in isoform 3 and isoform 4); 1..7; MKDSENK -> MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS (in isoform 2); 456..913; Missing (in isoform 3)

Domain & Motif Annotations

Compositional Bias

506..523; Polar residues; 554..572; Low complexity; 599..629; Polar residues; 654..669; Low complexity

Repeat

36..39; 1; 40..43; 2; 44..47; 3

Motif

409..417; SH3-binding

Domain (CC)

The J domain mediates interaction with HSPA8/HSC70 and is required for basket dissociation.

Domain (FT)

55..222; Phosphatase tensin-type; 228..366; C2 tensin-type; 849..913; J

Region

36..47; 3 X 4 AA approximate tandem repeats; 451..776; Disordered

Clinical Relevance5

Disease Involvement (4)

Disease variantNeurodegenerationParkinson diseaseParkinsonism

Antibody (2)

HPA031182 HPA054917

Interaction Protein

ENSG00000122705

Interaction Count

Interaction Dataset

biogrid_opencell

Supporting Publications3

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.
40596376	Proteomic profiling of plasma extracellular vesicles identifies signatures of innate immunity, coagulation, and endothelial activation in septic patients.	No abstract available
40689422	Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles.	No abstract available