Protein detail
FLNB
Filamin-B (FLN-B) (ABP-278) (ABP-280 homolog) (Actin-binding-like protein) (Beta-filamin) (Filamin homolog 1) (Fh1) (Filamin-3) (Thyroid autoantigen) (Truncated actin-binding protein) (Truncated ABP)
Entry name FLNB | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Filamin-B (FLN-B) (ABP-278) (ABP-280 homolog) (Actin-binding-like protein) (Beta-filamin) (Filamin homolog 1) (Fh1) (Filamin-3) (Thyroid autoantigen) (Truncated actin-binding protein) (Truncated ABP)
Protein Class (6)
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsTransporters
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
ABP-278FH1FLN1LLRS1TABPTAP
Gene Description
Filamin B
Chromosome
3
Position
58008398-58172251
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (12)
- GO:0001725 stress fiber
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005903 brush border
- GO:0005925 focal adhesion
- GO:0005938 cell cortex
- GO:0015629 actin cytoskeleton
- GO:0016020 membrane
- GO:0030018 Z disc
Page 1 of 2
Molecular Function (6)
Biological Process (3)
Reactome (4)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence14
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FLNB | LCK | P06239 | Y | 2,502 | phosphorylation | KEA | KEA:17570479 |
| FLNB | PRKCB | P05771 | S | 1,937 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FBLI1 | Q8WUP2 | FLNB | O75369 | Yes | Yes | HPRDHINTLit-BM-17SIGNOR | HPRD:12496242HINT:12496242SIGNOR:24165133Lit-BM-17:12496242HINT:33961781 | |
| COMPLEX:Q15369_Q15370_Q93034_Q9UBF6 | FLNB | O75369 | Yes | Yes | SIGNOR | SIGNOR:19300455 | ||
| ASB2 | Q96Q27 | FLNB | O75369 | Yes | Yes | SIGNOR | SIGNOR:19300455 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FLNBNASPPRMT3VCP | O60678O75369P49321P55072 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_375 | ||
| FLNB | O75369 | 4 | PDB | PDB:3ferPDB:5dcpPDB:4b7l | ||
| CACYBPFLNBHNRNPA0NUP210 | O75369Q13151Q8TEM1Q9HB71 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_236 | ||
| APOHRFLNBZCCHC17 | P02749Q8N5W9Q9NP64 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37886648 |
Sequence, Structure & Domains
Sequences
Length
2,602
Mass
278,164
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=1; Synonyms=ABP-278; IsoId=O75369-1; Sequence=Displayed; Name=2; Synonyms=ABP-276; IsoId=O75369-2; Sequence=VSP_008773; Name=3; Synonyms=Var-1; IsoId=O75369-3; Sequence=VSP_008774; Name=7; IsoId=O75369-7; Sequence=VSP_024113, VSP_024114, VSP_024115; Name=4; Synonyms=Var-3; IsoId=O75369-4; Sequence=VSP_008775, VSP_008776; Name=5; Synonyms=Var-2; IsoId=O75369-5; Sequence=VSP_008777, VSP_008778; Name=6; Synonyms=Var-1-DeltaH1; IsoId=O75369-6; Sequence=VSP_008773, VSP_008774; Name=8; IsoId=O75369-8; Sequence=VSP_043446; Name=9; IsoId=O75369-9; Sequence=VSP_024115
Alternative Sequence
1..169; Missing (in isoform 7); 170..181; ALGALVDSCAPG -> MQEHSTRRRSLS (in isoform 7); 1463; R -> RADDTDSQSWRSPLKALSEFFKGDPKGDFNKT (in isoform 8); 1704..1727; Missing (in isoform 2 and isoform 6); 1717..1727; Missing (in isoform 7 and isoform 9); 2081..2121; Missing (in isoform 3 and isoform 6); 2123..2150; EINSSDMSAHVTSPSGRVTEAEIVPMGK -> GVRVMNCSAQILWGWRVQFHTGSRNQQQ (in isoform 4); 2123..2146; EINSSDMSAHVTSPSGRVTEAEIV -> GVRVMNCSAQILWGWRVQFHTGSR (in isoform 5); 2147..2602; Missing (in isoform 5); 2151..2602; Missing (in isoform 4)
3D Structural Models
Turn
40..46; 282..284; 1066..1068; 1173..1175; 1354..1356; 1429..1431; 1448..1450; 1780..1782; 1958..1960; 2011..2013; 2028..2030; 2201..2203; 2384..2386; 2393..2395; 2410..2412; 2512..2514; 2538..2540
Helix
5..10; 13..16; 17..30; 31..33; 48..58; 73..89; 99..103; 107..122; 141..152; 163..165; 169..178; 186..188; 194..208; 217..220; 227..234; 236..239; 254..256; 262..264; 1040..1042; 1048..1051; 1133..1135; 1141..1143; 1236..1239; 1336..1339; 1517..1519; 1525..1527; 1622..1624; 1829..1831; 2002..2004; 2126..2128; 2193..2195; 2520..2523
Beta Strand
258..261; 265..267; 275..280; 289..294; 300..302; 304..309; 313..319; 323..333; 342..347; 1044..1047; 1052..1054; 1059..1064; 1073..1077; 1079..1081; 1084..1089; 1091..1100; 1102..1115; 1122..1128; 1136..1140; 1154..1160; 1166..1172; 1179..1184; 1188..1195; 1200..1208; 1217..1223; 1232..1235; 1249..1254; 1256..1258; 1273..1275; 1281..1284; 1286..1294; 1300..1310; 1317..1321; 1332..1335; 1347..1352; 1361..1369; 1374..1377; 1379..1381; 1383..1387; 1393..1401; 1410..1416; 1425..1428; 1441..1446; 1455..1460; 1462..1464; 1475..1483; 1489..1501; 1506..1512; 1520..1524; 1538..1546; 1566..1570; 1573..1580; 1586..1590; 1593..1596; 1603..1609; 1618..1621; 1625..1639; 1641..1643; 1648..1653; 1663..1666; 1672..1677; 1682..1692; 1699..1705; 1747..1751; 1760..1765; 1775..1779; 1783..1788; 1794..1802; 1811..1816; 1825..1828; 1833..1835; 1840..1845; 1855..1863; 1868..1870; 1872..1880; 1886..1898; 1903..1909; 1924..1927; 1941..1943; 1952..1957; 1961..1966; 1972..1977; 1979..1984; 1989..1994; 1997..1999; 2006..2010; 2014..2016; 2021..2026; 2035..2043; 2057..2061; 2067..2077; 2084..2090; 2111..2113; 2118..2120; 2130..2134; 2140..2142; 2144..2147; 2149..2157; 2164..2175; 2180..2185; 2206..2208; 2210..2214; 2219..2221; 2226..2234; 2236..2240; 2250..2256; 2258..2266; 2275..2281; 2288..2294; 2306..2314; 2320..2324; 2330..2332; 2334..2337; 2340..2347; 2352..2365; 2370..2375; 2388..2392; 2403..2408; 2417..2425; 2430..2433; 2435..2442; 2448..2459; 2466..2473; 2516..2519; 2531..2536; 2545..2547; 2557..2565; 2568..2574; 2579..2583; 2585..2591; 2596..2601
3D Structure
NMR spectroscopy (17); X-ray crystallography (6)
Domain & Motif Annotations
Repeat
249..347; Filamin 1; 349..446; Filamin 2; 447..543; Filamin 3; 544..636; Filamin 4; 640..736; Filamin 5; 737..839; Filamin 6; 840..938; Filamin 7; 939..1034; Filamin 8; 1035..1127; Filamin 9; 1128..1222; Filamin 10; 1223..1322; Filamin 11; 1323..1415; Filamin 12; 1416..1511; Filamin 13; 1512..1608; Filamin 14; 1609..1704; Filamin 15; 1729..1813; Filamin 16; 1816..1908; Filamin 17; 1919..1994; Filamin 18; 1997..2089; Filamin 19; 2091..2185; Filamin 20; 2188..2280; Filamin 21; 2282..2375; Filamin 22; 2379..2471; Filamin 23; 2507..2601; Filamin 24
Domain (CC)
Comprised of a NH2-terminal actin-binding domain, 24 internally homologous repeats and two hinge regions. Repeat 24 and the second hinge domain are important for dimer formation. The first hinge region prevents binding to ITGA and ITGB subunits.
Domain (FT)
16..122; Calponin-homology (CH) 1; 139..242; Calponin-homology (CH) 2
Region
1..239; Actin-binding; 244..267; Disordered; 1128..1511; Interaction with FBLP1; 1705..1728; Hinge 1; 1862..2148; Interaction with the cytoplasmic tail of GP1BA; 2060..2225; Interaction with FLNA 1; 2130..2602; Interaction with INPPL1; 2472..2602; Self-association site, tail; 2472..2506; Hinge 2; 2507..2602; Interaction with FLNA 2
Protein Families
Filamin family
Sequence Similarities
Belongs to the filamin family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No related sentences available |