Protein detail
HSBP1
Heat shock factor-binding protein 1 (Nasopharyngeal carcinoma-associated antigen 13) (NPC-A-13)
Entry name HSBP1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 6 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Heat shock factor-binding protein 1 (Nasopharyngeal carcinoma-associated antigen 13) (NPC-A-13)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
6
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
Reactome (5)
Mediation Categories
Other mediation
Relations & Evidence12
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| HSBP1 | O75506 | HSF1 | Q00613 | Yes | No | Yes | SIGNORHPRDSPIKE_LCLit-BM-17SPIKE | SPIKE_LC:9869631Lit-BM-17:9649501SPIKE:9649501SPIKE_LC:9649501SPIKE:9869631HPRD:9649501SIGNOR:9649501SPIKE_LC:16189514 |
| HSBP1 | O75506 | COMPLEX:A8K0Z3_Q12768_Q2M389_Q9Y3C0_Q9Y4E1 | Yes | Yes | No | SIGNOR | SIGNOR:29844016 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP5F1AATP5F1BATP5F1CATP5F1EATP5MEATP5MFATP5MGATP5PBATP5PDATP5POHSBP1TSPAN6 | O43657O75506O75947O75964P06576P24539P25705P36542P48047P56134P56381P56385 | 1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7327 | ||
| HSBP1 | O75506 | 2 | PDB | PDB:3ci9 | ||
| HSBP1RAB2ARAB4ARAB5ARAB7ARBSNVPS45 | O75506P20338P20339P51149P61019Q9H1K0Q9NRW7 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5056 | ||
| HSBP1RAB14RAB4ARAB5ARAB7ARBSNVPS45 | O75506P20338P20339P51149P61106Q9H1K0Q9NRW7 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7491 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa) | 1 | 40326690 |
Sequence, Structure & Domains7
Sequences
Length
76
Mass
8,544
Sequence
MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
3D Structural Models
Helix
9..46
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
HSBP1 family
Sequence Similarities
Belongs to the HSBP1 family.
Clinical Relevance3
Interaction Protein (4)
ENSG00000120860ENSG00000123395ENSG00000204536ENSG00000254999
Interaction Count
4
Interaction Dataset (3)
intact_biogrid_bioplexbiogrid_opencellintact_biogrid
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 35194965 | Muscle cells of sporadic amyotrophic lateral sclerosis patients secrete neurotoxic vesicles. | No abstract available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No abstract available |