Protein detail

RPC9

DNA-directed RNA polymerase III subunit RPC9 (RNA polymerase III subunit C9) (Calcitonin gene-related peptide-receptor component protein) (CGRP-RCP) (CGRP-receptor component protein) (CGRPRCP) (HsC17)

Entry name RPC9	UniProt ID O75575	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Essential proteinsPredicted intracellular proteinsRNA polymerase related proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein Class (3)

Essential proteinsPredicted intracellular proteinsRNA polymerase related proteins

Protein Function (2)

RNA polymerase related proteins
Predicted intracellular proteins

Ensembl

ENSG00000241258

Entrez Gene Symbol

CRCP

Gene Synonym (5)

C17CGRP-RCPPOLR3IRCPRCP9

Gene Description

CGRP receptor component

Chromosome

Position

66114604-66154568

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization4

Tissue Specificskin 1Cell SpecificEndometrial luminal cellsSecretome LocationSecreted - unknown locationSecretome FunctionReceptor

Function & Pathway8

Protein Function (2)

RNA polymerase related proteins
Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

Biological Process (3)

KEGG

hsa03020 RNA polymerase

Reactome (7)

Canonical Pathways (3)

M3008 Naba ecm glycoproteins
M5884 Naba core matrisome
M5889 Naba matrisome

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence15

Ligand-Receptor Signaling (8)

8 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	GO_Intercell	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CRCP GTF3C3 KLF16 POLR2E POLR2F POLR2H POLR2L POLR3A POLR3B POLR3C POLR3D POLR3E POLR3F POLR3G UBC	O14802 O15318 O75575 P05423 P0CG48 P19388 P52434 P61218 P62875 Q9BUI4 Q9BXK1 Q9H1D9 Q9NVU0 Q9NW08 Q9Y5Q9	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5792
CRCP GTF3C3 POLR2E POLR2F POLR2H POLR2L POLR3A POLR3B POLR3C POLR3D POLR3E POLR3F POLR3G U2AF2 WT1	O14802 O15318 O75575 P05423 P19388 P19544 P26368 P52434 P61218 P62875 Q9BUI4 Q9H1D9 Q9NVU0 Q9NW08 Q9Y5Q9	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7604
CRCP POLR3A POLR3B POLR3C POLR3D POLR3E POLR3F POLR3G POLR3GL POLR3H	O14802 O15318 O75575 P05423 Q9BT43 Q9BUI4 Q9H1D9 Q9NVU0 Q9NW08 Q9Y535	0:0:0:0:0:0:0:0:0:0	hu.MAP2
CRCP POLR3A POLR3B POLR3C POLR3D POLR3F POLR3G POLR3GL POLR3H	O14802 O15318 O75575 P05423 Q9BT43 Q9BUI4 Q9H1D9 Q9NW08 Q9Y535	0:0:0:0:0:0:0:0:0	hu.MAP2
CRCP POLR3A POLR3B POLR3C POLR3D POLR3E POLR3F POLR3G POLR3H POLR3K	O14802 O15318 O75575 P05423 Q9BUI4 Q9H1D9 Q9NVU0 Q9NW08 Q9Y2Y1 Q9Y535	0:0:0:0:0:0:0:0:0:0	hu.MAP
CRCP POLR3A POLR3B POLR3C POLR3D POLR3F POLR3G POLR3H	O14802 O15318 O75575 P05423 Q9BUI4 Q9H1D9 Q9NW08 Q9Y535	0:0:0:0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	R Sequencing	2	40730843 38207106

Sequence, Structure & Domains12

Sequences

Length

148

Mass

16,871

Sequence

MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O75575-1; Sequence=Displayed; Name=2; IsoId=O75575-2; Sequence=VSP_007538; Name=3; IsoId=O75575-3; Sequence=VSP_043249, VSP_007538; Name=4; IsoId=O75575-4; Sequence=VSP_046273

Alternative Sequence

1..13; MEVKDANSALLSN -> MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN (in isoform 3); 4..80; Missing (in isoform 4); 14..46; Missing (in isoform 2 and isoform 3)

3D Structural Models

Turn

57..60

Helix

13..24; 38..53; 63..73; 74..76; 80..89; 95..100; 104..107; 110..123

Beta Strand

2..7; 27..30; 34..36; 101..103

3D Structure

Electron microscopy (29)

Domain & Motif Annotations

Region

124..148; Disordered

Protein Families

Eukaryotic RPC9 RNA polymerase subunit family

Sequence Similarities

Belongs to the eukaryotic RPC9 RNA polymerase subunit family.

Clinical Relevance4

Antibody (2)

HPA006883 HPA007216

Interaction Protein (14)

ENSG00000013503ENSG00000058600ENSG00000099817ENSG00000100142ENSG00000100413ENSG00000121851ENSG00000132664ENSG00000147669ENSG00000148606ENSG00000163882ENSG00000168495ENSG00000171453ENSG00000186141ENSG00000186184

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications1

PMID	Title	Abstract
37563857	Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications.	No abstract available