Protein detail
PALM
Paralemmin-1 (Paralemmin)
Entry name PALM | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Paralemmin-1 (Paralemmin)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
KIAA0270PALM1
Gene Description
Paralemmin
Chromosome
19
Position
708935-748329
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificLymphatic endothelial cellsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (10)
- GO:0005654 nucleoplasm
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0014069 postsynaptic density
- GO:0016323 basolateral plasma membrane
- GO:0016327 apicolateral plasma membrane
- GO:0030424 axon
- GO:0031410 cytoplasmic vesicle
- GO:0031527 filopodium membrane
- GO:0043197 dendritic spine
Molecular Function (2)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence18
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PALM | EGF | P01133 | S | 138 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | EGF | P01133 | T | 141 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | EGF | P01133 | T | 145 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | MAPK14 | Q16539 | T | 141 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| basolateral_cell_membrane | plasma_membrane | UniProt_location | |||||
| apicolateral_cell_membrane | plasma_membrane | UniProt_location | |||||
| basolateral_cell_membrane | plasma_membrane | Ramilowski_location | |||||
| plasma_membrane | plasma_membrane | Ramilowski_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GLIPR2PALM | O75781Q9H4G4 | 0:0 | hu.MAP | |||
| AKAP3C2orf88GPR161PALM2AKAP2PRKAR1APRKAR1B | O75969P10644P31321Q8N6U8Q9BSF0Q9Y2D5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| COILKYNULACTB2NUP210PALM2AKAP2PPP4R3BSMS | P38432P52788Q16719Q53H82Q5MIZ7Q8IXS6Q8TEM1 | 0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_543 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometry | 1 | 28396511 |
Sequence, Structure & Domains
Sequences
Length
387
Mass
42,076
Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Paralemmin-L; IsoId=O75781-1; Sequence=Displayed; Name=2; Synonyms=Paralemmin-S; IsoId=O75781-2; Sequence=VSP_003918
Alternative Sequence
168..211; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
31..41; Basic and acidic residues; 69..102; Basic and acidic residues; 104..117; Low complexity; 286..296; Low complexity
Coiled Coil
9..101
Region
31..160; Disordered; 247..296; Disordered; 335..378; Disordered
Protein Families
Paralemmin family
Sequence Similarities
Belongs to the paralemmin family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36028467 | Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment. | No related sentences available |