Protein detail
PALM
Paralemmin-1 (Paralemmin)
Entry name PALM | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Paralemmin-1 (Paralemmin)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
KIAA0270PALM1
Gene Description
Paralemmin
Chromosome
19
Position
708935-748329
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificLymphatic endothelial cellsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0005654 nucleoplasm
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0014069 postsynaptic density
- GO:0016323 basolateral plasma membrane
- GO:0016327 apicolateral plasma membrane
- GO:0030424 axon
- GO:0031410 cytoplasmic vesicle
- GO:0031527 filopodium membrane
- GO:0043197 dendritic spine
Molecular Function
Biological Process
Mediation Categories
Receptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PALM | EGF | P01133 | S | 138 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | EGF | P01133 | T | 141 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | EGF | P01133 | T | 145 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| PALM | MAPK14 | Q16539 | T | 141 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apicolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GLIPR2PALM | O75781Q9H4G4 | 0:0 | hu.MAP | |||
| AKAP3C2orf88GPR161PALM2AKAP2PRKAR1APRKAR1B | O75969P10644P31321Q8N6U8Q9BSF0Q9Y2D5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| COILKYNULACTB2NUP210PALM2AKAP2PPP4R3BSMS | P38432P52788Q16719Q53H82Q5MIZ7Q8IXS6Q8TEM1 | 0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_543 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometry | 1 | 28396511 |
Sequence, Structure & Domains
Sequences
Length
387
Mass
42,076
Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Paralemmin-L; IsoId=O75781-1; Sequence=Displayed; Name=2; Synonyms=Paralemmin-S; IsoId=O75781-2; Sequence=VSP_003918
Alternative Sequence
168..211; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
31..41; Basic and acidic residues; 69..102; Basic and acidic residues; 104..117; Low complexity; 286..296; Low complexity
Coiled Coil
9..101
Region
31..160; Disordered; 247..296; Disordered; 335..378; Disordered
Protein Families
Paralemmin family
Sequence Similarities
Belongs to the paralemmin family.