Protein detail
SASH3
SAM and SH3 domain-containing protein 3 (SH3 protein expressed in lymphocytes homolog)
Entry name SASH3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 8 | Transmembrane count | Protein classification Disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
SAM and SH3 domain-containing protein 3 (SH3 protein expressed in lymphocytes homolog)
Protein Class (2)
Disease related genesPredicted intracellular proteins
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
753P9CXorf9HACS2SH3D6CSLY
Gene Description
SAM and SH3 domain containing 3
Chromosome
X
Position
129779949-129795201
Supporting publications (n)
8
EVMP confidence score
0.50
Fluorescence & Localization2
Cell Specificmonocytes
Function & Pathway4
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (2)
Biological Process (3)
Mediation Categories (2)
Adhesion and uptake mediationImmune mediation
Relations & Evidence6
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SASH3 | PRKCB | P05771 | S | 27 | phosphorylation | KEA | KEA:17570479 |
| SASH3 | RPS6KA3 | P51812 | S | 27 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Sequence, Structure & Domains6
Sequences
Length
380
Mass
41,595
Sequence
MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKVGSFKFIYVDVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSLAGAP
Domain & Motif Annotations
Compositional Bias
22..41; Low complexity; 143..152; Polar residues; 153..164; Low complexity; 241..255; Basic residues; 318..327; Acidic residues
Domain (FT)
173..234; SH3; 252..316; SAM
Region
1..76; Disordered; 98..174; Disordered; 237..256; Disordered; 318..380; Disordered
Clinical Relevance2
Disease Involvement
Disease variant
Antibody
Supporting Publications7
| PMID | Title | Abstract |
|---|---|---|
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |