Protein detail

DIRA1

GTP-binding protein Di-Ras1 (Distinct subgroup of the Ras family member 1) (Ras-related inhibitor of cell growth) (Rig) (Small GTP-binding tumor suppressor 1)

Entry name DIRA1	UniProt ID O95057	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

GTP-binding protein Di-Ras1 (Distinct subgroup of the Ras family member 1) (Ras-related inhibitor of cell growth) (Rig) (Small GTP-binding tumor suppressor 1)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000176490

Entrez Gene Symbol

DIRAS1

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Cell SpecificRetinal horizontal cells

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0005886 plasma membrane

Molecular Function (4)

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence13

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (7)

7 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1 UBTF UNC13B	O14795 O95057 P17480 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0:0:0	hu.MAP2
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1 UNC13B	O14795 O95057 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0:0	hu.MAP2
DIRAS1	O95057	4	PDB	PDB:2gf0
AKR1D1 DIRAS1	O95057 P51857	0:0	hu.MAP
DIRAS1 RAP1GDS1	O95057 P52306	0:0	hu.MAP2
DIRAS1 DIRAS2 OSBPL2 RAP1A RAP1GDS1	O95057 P52306 P62834 Q96HU8 Q9H1P3	0:0:0:0:0	hu.MAP2
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1	O95057 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryR Sequencing	6	40189497 38113368 40465195 37322475 36146834 38207106

Sequence, Structure & Domains12

Sequences

Length

198

Mass

22,329

Sequence

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

3D Structural Models

Turn

151..154

Helix

20..29; 64..66; 69..78; 91..95; 98..108; 111..113; 132..142; 157..167

Beta Strand

8..14; 42..50; 53..61; 80..87; 116..121; 145..148; 169..171

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

178..192; Basic and acidic residues

Motif

36..44; Effector region

Region

178..198; Disordered

Protein Families (2)

Small GTPase superfamily
Di-Ras family

Sequence Similarities

Belongs to the small GTPase superfamily. Di-Ras family.

Supporting Publications2

PMID	Title	Abstract
37922300	Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.	No abstract available
40784529	Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine.	No abstract available