Protein detail

DIRA1

GTP-binding protein Di-Ras1 (Distinct subgroup of the Ras family member 1) (Ras-related inhibitor of cell growth) (Rig) (Small GTP-binding tumor suppressor 1)

Protein symbol DIRA1	UniProt ID O95057	EVMP score 0.50
Frequency 2	Transmembrane count	Protein classification

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

GTP-binding protein Di-Ras1 (Distinct subgroup of the Ras family member 1) (Ras-related inhibitor of cell growth) (Rig) (Small GTP-binding tumor suppressor 1)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000176490

Entrez Gene Symbol

DIRAS1

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificRetinal horizontal cells

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0005886 plasma membrane

Molecular Function

Biological Process

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

7 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1 UBTF UNC13B	O14795 O95057 P17480 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0:0:0	hu.MAP2
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1 UNC13B	O14795 O95057 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0:0	hu.MAP2
DIRAS1	O95057	4	PDB	PDB:2gf0
AKR1D1 DIRAS1	O95057 P51857	0:0	hu.MAP
DIRAS1 RAP1GDS1	O95057 P52306	0:0	hu.MAP2
DIRAS1 DIRAS2 OSBPL2 RAP1A RAP1GDS1	O95057 P52306 P62834 Q96HU8 Q9H1P3	0:0:0:0:0	hu.MAP2
DIRAS1 DIRAS2 PLEKHB1 RAP1A RAP1GDS1	O95057 P52306 P62834 Q96HU8 Q9UF11	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryR Sequencing	6	40189497 38113368 40465195 37322475 36146834 38207106

Sequence, Structure & Domains

Sequences

Length

198

Mass

22,329

Sequence

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

3D Structural Models

Turn

151..154

Helix

20..29; 64..66; 69..78; 91..95; 98..108; 111..113; 132..142; 157..167

Beta Strand

8..14; 42..50; 53..61; 80..87; 116..121; 145..148; 169..171

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

178..192; Basic and acidic residues

Motif

36..44; Effector region

Region

178..198; Disordered

Protein Families

Small GTPase superfamily
Di-Ras family

Sequence Similarities

Belongs to the small GTPase superfamily. Di-Ras family.

Clinical Relevance