Protein detail
GNAS3
Neuroendocrine secretory protein 55 (NESP55) [Cleaved into: LHAL tetrapeptide; GPIPIRRH peptide]
Entry name GNAS3 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Neuroendocrine secretory protein 55 (NESP55) [Cleaved into: LHAL tetrapeptide; GPIPIRRH peptide]
Protein Class
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Parathyroid diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Endocrine and metabolic diseases:Adrenal gland diseases
Ensembl
Entrez Gene Symbol
Gene Synonym
GNAS1GNASXLGPSANESPNESP55SCG6SgVI
Gene Description
GNAS complex locus
Chromosome
20
Position
58839718-58911192
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificLate spermatids
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Parathyroid diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Endocrine and metabolic diseases:Adrenal gland diseases
Cellular Component
- GO:0001726 ruffle
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005834 heterotrimeric G-protein complex
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030133 transport vesicle
- GO:0032588 trans-Golgi network membrane
- GO:0048471 perinuclear region of cytoplasm
- GO:0070062 extracellular exosome
Molecular Function
- GO:0003674 molecular_function
- GO:0003924 GTPase activity
- GO:0003925 G protein activity
- GO:0005159 insulin-like growth factor receptor binding
- GO:0005515 protein binding
- GO:0005525 GTP binding
- GO:0010856 adenylate cyclase activator activity
- GO:0031683 G-protein beta/gamma-subunit complex binding
- GO:0031698 beta-2 adrenergic receptor binding
- GO:0031748 D1 dopamine receptor binding
- GO:0031852 mu-type opioid receptor binding
- GO:0035255 ionotropic glutamate receptor binding
- GO:0046872 metal ion binding
- GO:0051430 corticotropin-releasing hormone receptor 1 binding
Biological Process
KEGG
- hsa01522 Endocrine resistance
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04540 Gap junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04714 Thermogenesis
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04912 GnRH signaling pathway
- KEGG:hsa04913 Ovarian steroidogenesis
- KEGG:hsa04915 Estrogen signaling pathway
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04922 Glucagon signaling pathway
- KEGG:hsa04923 Regulation of lipolysis in adipocytes
- KEGG:hsa04924 Renin secretion
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa04927 Cortisol synthesis and secretion
- KEGG:hsa04928 Parathyroid hormone synthesis, secretion and action
- KEGG:hsa04934 Cushing syndrome
- KEGG:hsa04935 Growth hormone synthesis, secretion and action
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04962 Vasopressin-regulated water reabsorption
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04971 Gastric acid secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa04976 Bile secretion
- KEGG:hsa05012 Parkinson disease
- KEGG:hsa05030 Cocaine addiction
- KEGG:hsa05031 Amphetamine addiction
- KEGG:hsa05032 Morphine addiction
- KEGG:hsa05034 Alcoholism
- KEGG:hsa05110 Vibrio cholerae infection
- KEGG:hsa05142 Chagas disease
- KEGG:hsa05146 Amoebiasis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05207 Chemical carcinogenesis - receptor activation
- KEGG:hsa05414 Dilated cardiomyopathy
Reactome
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-381676 glucagon like peptide 1 glp1 regulates insulin secretion
- R-hsa-163359 glucagon signaling in metabolic regulation
- R-hsa-420092 glucagon type ligand receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-9634597 gper1 signaling
- R-hsa-418594 g alpha i signalling events
- R-hsa-418555 g alpha s signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-5610787 hedgehog off state
- R-hsa-109582 hemostasis
- R-hsa-9856530 high laminar flow shear stress activates signaling by piezo1 and pecam1 cdh5 kdr in endothelial cells
- R-hsa-5663205 infectious disease
- R-hsa-163685 integration of energy metabolism
- R-hsa-9658195 leishmania infection
- R-hsa-164378 pka activation in glucagon signalling
- R-hsa-418346 platelet homeostasis
- R-hsa-392851 prostacyclin signalling through prostacyclin receptor
- R-hsa-422356 regulation of insulin secretion
- R-hsa-372790 signaling by gpcr
- R-hsa-5358351 signaling by hedgehog
- R-hsa-382551 transport of small molecules
- R-hsa-432040 vasopressin regulates renal water homeostasis via aquaporins
Canonical Pathways
- M56 Pid lpa4 pathway
- M8 Pid endothelin pathway
- M15 Pid lysophospholipid pathway
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
88 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
Regulatory Interaction Network
93 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GPER1 | Q99527 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:10696571 |
| EDNRB | P24530 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| MRGX1 | Q96LB2 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| GNAS3 | O95467 | COMPLEX:P27986_P42336 | Yes | Yes | No | SIGNOR | SIGNOR:22179044 | |
| MC5R | P33032 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:20371771SIGNOR:31160049 |
| GRM6 | O15303 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:20055706 |
| PE2R1 | P34995 | GNAS3 | O95467 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| GP161 | Q8N6U8 | GNAS3 | O95467 | Yes | Yes | No | HINTSIGNOR | HINT:37292845SIGNOR:23332756 |
| PD2R | Q13258 | GNAS3 | O95467 | Yes | Yes | No | HPRDSIGNOR | HPRD:12672054SIGNOR:31160049 |
| V1AR | P37288 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Protein Complex Composition
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAS-L-GNB1-GNG1 complex | GNASGNB5GNGT1 | O14775P63092P63211 | 0:0:0 | CORUM | CORUM:7146 | 25733868 |
| GNAS-L-GNB5-GNG12 complex | GNASGNB5GNG12 | O14775P63092Q9UBI6 | 0:0:0 | CORUM | CORUM:7208 | 25733868 |
| GNAS-L-GNB5-GNG13 complex | GNASGNB5GNG13 | O14775P63092Q9P2W3 | 0:0:0 | CORUM | CORUM:7213 | 25733868 |
| GNAS-L-GNB5-GNG4 complex | GNASGNB5GNG4 | O14775P50150P63092 | 0:0:0 | CORUM | CORUM:7164 | 25733868 |
| GNAS-L-GNB5-GNG8 complex | GNASGNB5GNG8 | O14775P63092Q9UK08 | 0:0:0 | CORUM | CORUM:7179 | 25733868 |
| DPCDGNASMTORRPAP3RPL26RUVBL1RUVBL2TTI1 | O43156O95467P42345P61254Q9BVM2Q9H6T3Q9Y230Q9Y265 | 1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7677 | ||
| GNAS | P63092 | 4 | PDB | PDB:7e5e |
Isolation & Detection Technology
0 records.
Sequence, Structure & Domains
Sequences
Length
245
Mass
28,029
Sequence
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH
Alternative Products
Event=Alternative splicing; Named isoforms=8; Name=Nesp55; IsoId=O95467-1; Sequence=Displayed; Name=XLas-1; IsoId=Q5JWF2-1; Sequence=External; Name=XLas-2; IsoId=Q5JWF2-2; Sequence=External; Name=XLas-3; IsoId=Q5JWF2-3; Sequence=External; Name=Gnas-1; Synonyms=Alpha-S2, GNASl, Alpha-S-long; IsoId=P63092-1, P04895-1; Sequence=External; Name=Gnas-2; Synonyms=Alpha-S1, GNASs, Alpha-S-short; IsoId=P63092-2, P04895-2; Sequence=External; Name=3; IsoId=P63092-3; Sequence=External; Name=4; IsoId=P63092-4; Sequence=External
3D Structural Models
Domain & Motif Annotations
Compositional Bias
101..129; Acidic residues; 171..181; Low complexity; 187..215; Basic and acidic residues; 216..225; Basic residues
Region
70..245; Disordered
Protein Families
NESP55 family
Sequence Similarities
Belongs to the NESP55 family.
Clinical Relevance
Disease Involvement
Cancer-related genesCushing syndromeDisease variantDwarfismObesityProto-oncogene
Drugs
CHEMBL:CHEMBL429095WIN 62,577CHEMBL:CHEMBL560296CHEMBL:CHEMBL527586ACID BLUE 129CHEMBL:CHEMBL1561747CHEMBL:CHEMBL515505FLUOROURACILCHEMBL:CHEMBL1392244CHEMBL:CHEMBL1500913NICLOSAMIDETRIACETINETOCARLIDEMIFEPRISTONECHEMBL:CHEMBL585408CHEMBL:CHEMBL505670CHEMBL:CHEMBL2002487CLIOXANIDE(3Z)-N,N-DIMETHYL-2-OXO-3-(4,5,6,7-TETRAHYDRO-1H-INDOL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOLE-5-SULFONAMIDETETRAETHYLAMMONIUM CHLORIDECHEMBL:CHEMBL5815749,10-PHENANTHRENEQUINONECHEMBL:CHEMBL530291CHEMBL:CHEMBL578878CHEMBL:CHEMBL1417470AMITRIPTYLINE HYDROCHLORIDECHEMBL:CHEMBL1456848CHEMBL:CHEMBL581251CHEMBL:CHEMBL1506226CHEMBL:CHEMBL581044JNJ1661010CISPLATINCHEMBL:CHEMBL529918GARCINONE ECHEMBL:CHEMBL252417
Interaction Protein
ENSG00000078369
Interaction Count
1
Interaction Dataset
intact_biogrid_opencell