Protein detail
GNAS3
Neuroendocrine secretory protein 55 (NESP55) [Cleaved into: LHAL tetrapeptide; GPIPIRRH peptide]
Entry name GNAS3 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neuroendocrine secretory protein 55 (NESP55) [Cleaved into: LHAL tetrapeptide; GPIPIRRH peptide]
Protein Class (7)
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (11)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Parathyroid diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Page 1 of 2
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
GNAS1GNASXLGPSANESPNESP55SCG6SgVI
Gene Description
GNAS complex locus
Chromosome
20
Position
58839718-58911192
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificLate spermatids
Function & Pathway
Protein Function (11)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Parathyroid diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Page 1 of 2
Cellular Component (13)
- GO:0001726 ruffle
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005834 heterotrimeric G-protein complex
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030133 transport vesicle
Page 1 of 2
Molecular Function (14)
- GO:0003674 molecular_function
- GO:0003924 GTPase activity
- GO:0003925 G protein activity
- GO:0005159 insulin-like growth factor receptor binding
- GO:0005515 protein binding
- GO:0005525 GTP binding
- GO:0010856 adenylate cyclase activator activity
- GO:0031683 G-protein beta/gamma-subunit complex binding
- GO:0031698 beta-2 adrenergic receptor binding
- GO:0031748 D1 dopamine receptor binding
Page 1 of 2
Biological Process (3)
KEGG (53)
- hsa01522 Endocrine resistance
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04540 Gap junction
Page 1 of 6
Reactome (28)
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-381676 glucagon like peptide 1 glp1 regulates insulin secretion
- R-hsa-163359 glucagon signaling in metabolic regulation
- R-hsa-420092 glucagon type ligand receptors
- R-hsa-500792 gpcr ligand binding
Page 1 of 3
Canonical Pathways (3)
- M56 Pid lpa4 pathway
- M8 Pid endothelin pathway
- M15 Pid lysophospholipid pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence188
Ligand-Receptor Signaling (88)
88 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | ||||
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | ||||
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | ||||
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes |
Regulatory Interaction Network (93)
93 records.
Page 1 of 10Next
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAS-L-GNB1-GNG1 complex | GNASGNB5GNGT1 | O14775P63092P63211 | 0:0:0 | CORUM | CORUM:7146 | 25733868 |
| GNAS-L-GNB5-GNG12 complex | GNASGNB5GNG12 | O14775P63092Q9UBI6 | 0:0:0 | CORUM | CORUM:7208 | 25733868 |
| GNAS-L-GNB5-GNG13 complex | GNASGNB5GNG13 | O14775P63092Q9P2W3 | 0:0:0 | CORUM | CORUM:7213 | 25733868 |
| GNAS-L-GNB5-GNG4 complex | GNASGNB5GNG4 | O14775P50150P63092 | 0:0:0 | CORUM | CORUM:7164 | 25733868 |
| GNAS-L-GNB5-GNG8 complex | GNASGNB5GNG8 | O14775P63092Q9UK08 | 0:0:0 | CORUM | CORUM:7179 | 25733868 |
| DPCDGNASMTORRPAP3RPL26RUVBL1RUVBL2TTI1 | O43156O95467P42345P61254Q9BVM2Q9H6T3Q9Y230Q9Y265 | 1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7677 | ||
| GNAS | P63092 | 4 | PDB | PDB:7e5e |
Sequence, Structure & Domains
Sequences
Length
245
Mass
28,029
Sequence
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH
Alternative Products
Event=Alternative splicing; Named isoforms=8; Name=Nesp55; IsoId=O95467-1; Sequence=Displayed; Name=XLas-1; IsoId=Q5JWF2-1; Sequence=External; Name=XLas-2; IsoId=Q5JWF2-2; Sequence=External; Name=XLas-3; IsoId=Q5JWF2-3; Sequence=External; Name=Gnas-1; Synonyms=Alpha-S2, GNASl, Alpha-S-long; IsoId=P63092-1, P04895-1; Sequence=External; Name=Gnas-2; Synonyms=Alpha-S1, GNASs, Alpha-S-short; IsoId=P63092-2, P04895-2; Sequence=External; Name=3; IsoId=P63092-3; Sequence=External; Name=4; IsoId=P63092-4; Sequence=External
Domain & Motif Annotations
Compositional Bias
101..129; Acidic residues; 171..181; Low complexity; 187..215; Basic and acidic residues; 216..225; Basic residues
Region
70..245; Disordered
Protein Families
NESP55 family
Sequence Similarities
Belongs to the NESP55 family.
Clinical Relevance
Disease Involvement (6)
Cancer-related genesCushing syndromeDisease variantDwarfismObesityProto-oncogene
Related Diseases (3)
Drugs (35)
CHEMBL:CHEMBL429095WIN 62,577CHEMBL:CHEMBL560296CHEMBL:CHEMBL527586ACID BLUE 129CHEMBL:CHEMBL1561747CHEMBL:CHEMBL515505FLUOROURACILCHEMBL:CHEMBL1392244CHEMBL:CHEMBL1500913NICLOSAMIDETRIACETINETOCARLIDEMIFEPRISTONECHEMBL:CHEMBL585408CHEMBL:CHEMBL505670CHEMBL:CHEMBL2002487CLIOXANIDE(3Z)-N,N-DIMETHYL-2-OXO-3-(4,5,6,7-TETRAHYDRO-1H-INDOL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOLE-5-SULFONAMIDETETRAETHYLAMMONIUM CHLORIDECHEMBL:CHEMBL5815749,10-PHENANTHRENEQUINONECHEMBL:CHEMBL530291CHEMBL:CHEMBL578878CHEMBL:CHEMBL1417470AMITRIPTYLINE HYDROCHLORIDECHEMBL:CHEMBL1456848CHEMBL:CHEMBL581251CHEMBL:CHEMBL1506226CHEMBL:CHEMBL581044JNJ1661010CISPLATINCHEMBL:CHEMBL529918GARCINONE ECHEMBL:CHEMBL252417
Interaction Protein
ENSG00000078369
Interaction Count
1
Interaction Dataset
intact_biogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |