Protein detail
DQA1
HLA class II histocompatibility antigen, DQ alpha 1 chain (DC-1 alpha chain) (DC-alpha) (HLA-DCA) (MHC class II DQA1)
Entry name DQA1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Human disease related genesPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
HLA class II histocompatibility antigen, DQ alpha 1 chain (DC-1 alpha chain) (DC-alpha) (HLA-DCA) (MHC class II DQA1)
Protein Class (4)
Human disease related genesPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (7)
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Digestive system diseases:Gastrointestinal diseases
Transmembrane
217..239; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CELIAC1HLA-DQA
Gene Description
Major histocompatibility complex, class II, DQ alpha 1
Chromosome
6
Position
32628179-32647062
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Lineage SpecificNK-cells
Function & Pathway
Protein Function (7)
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Digestive system diseases:Gastrointestinal diseases
Cellular Component (12)
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
Page 1 of 2
Molecular Function (4)
KEGG (24)
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
Page 1 of 3
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
Page 1 of 2
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence44
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes |
Page 1 of 3Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARH9 | Q86YJ5 | DQA1 | P01909 | Yes | Yes | SIGNOR | SIGNOR:19457934 |
Protein Complex Composition (14)
14 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DQA1HLA-DQB1 | P01909P01920 | 2:2 | SIGNORPDB | SIGNOR:SIGNOR-C428PDB:1s9v | |
| Class II MHC | HLA-DQA1HLA-DQB2 | P01909P05538 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DOBHLA-DQA1 | P01909P13765 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMBHLA-DQA1 | P01909P28068 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DQA1HLA-DQB1 | CHEBI:166824CHEBI:53000P01909P01920 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DQA1HLA-DQB2 | CHEBI:166824CHEBI:53000P01909P05538 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOBHLA-DQA1 | CHEBI:166824CHEBI:53000P01909P13765 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMBHLA-DQA1 | CHEBI:166824CHEBI:53000P01909P28068 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| HLA-DQA1O19712 | O19712P01909 | 2:2 | PDB | PDB:8w86PDB:7sg0PDB:8w84PDB:6mffPDB:9ejgPDB:6mfgPDB:6u3mPDB:8w85PDB:8w83PDB:6u3n | ||
| CD74HLA-DQA1O19712 | O19712P01909P04233 | 1:1:1 | PDB | PDB:9ejh |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | FACSMass spectrometryWestern blottingImmunoelectron Microscopy | 9 | 320897433976615836398564348179062789410429045505395694062904550529148239 |
Sequence, Structure & Domains
Sequences
Length
254
Mass
27,805
Sequence
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL
3D Structural Models
Turn
41..44; 62..65; 102..104
Helix
72..76; 81..101; 212..243
Beta Strand
29..40; 45..52; 55..61; 66..71; 113..120; 124..126; 128..137; 143..148; 151..153; 157..159; 166..168; 170..178; 186..191; 195..197; 199..203
3D Structure
Electron microscopy (1); X-ray crystallography (27)
Domain & Motif Annotations
Domain (FT)
112..204; Ig-like C1-type
Region
24..119; Alpha-1; 120..203; Alpha-2; 204..216; Connecting peptide
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |