Protein detail
DRB1
HLA class II histocompatibility antigen, DRB1 beta chain (Human leukocyte antigen DRB1) (HLA-DRB1)
Entry name DRB1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
HLA class II histocompatibility antigen, DRB1 beta chain (Human leukocyte antigen DRB1) (HLA-DRB1)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Disease related genes
- Human disease related genes:Immune system diseases:Other immune system diseases
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Transmembrane
228..248; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HLA-DR1B
Gene Description
Major histocompatibility complex, class II, DR beta 1
Chromosome
6
Position
32577902-32589848
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBergmann glia
Function & Pathway
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Disease related genes
- Human disease related genes:Immune system diseases:Other immune system diseases
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component (19)
- GO:0000139 Golgi membrane
- GO:0001772 immunological synapse
- GO:0005615 extracellular space
- GO:0005765 lysosomal membrane
- GO:0005882 intermediate filament
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
Page 1 of 2
Molecular Function (8)
Biological Process (3)
KEGG (24)
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
Page 1 of 3
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
Page 1 of 2
Canonical Pathways (2)
- M165 Pid syndecan 4 pathway
- M187 Pid trkr pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence51
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| mhc | cell_surface_ligand | Almen2009 | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:P03205_P03212_P03231 | DRB1 | P01911 | Yes | Yes | SIGNOR | SIGNOR:8764069 |
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DOAHLA-DRB1 | P01911P06340 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DRB1 | P01911P28067 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DOAHLA-DRB1 | P01912P06340 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DRB1 | P01912P28067 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DRB1 | CHEBI:166824CHEBI:53000P01911P06340 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DRB1 | CHEBI:166824CHEBI:53000P01911P28067 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DRB1 | CHEBI:166824CHEBI:53000P01912P06340 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DRB1 | CHEBI:166824CHEBI:53000P01912P28067 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 |
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
266
Mass
29,966
Sequence
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
3D Structural Models
Turn
48..51; 71..73; 119..121
Helix
81..83; 84..91; 94..106; 108..115; 116..118
Beta Strand
36..47; 52..61; 64..70; 75..80; 127..134; 135..139; 142..154; 157..162; 165..167; 171..173; 180..182; 184..192; 196..198; 199..205; 209..211; 213..218
3D Structure
Electron microscopy (1); X-ray crystallography (103)
Domain & Motif Annotations
Domain (CC)
The beta-1 domain is a structural part of the peptide-binding cleft. It contains one alpha helix and 4 beta sheets, respectively forming part of the wall and the floor of the peptide-binding cleft. The other 4 beta sheets of the floor and the second alpha helix wall is formed by the alpha-1 domain of HLA-DRA. Forms hydrogen bonds with the peptide main chain via conserved amino acid in most HLA-DRB molecules. The polymorphic residues accomodate the side chains of the peptide conferring peptide specificity to distinct HLA-DRB1 alleles (PubMed:28467828, PubMed:8145819, PubMed:9354468, PubMed:9782128). The peptide-bound beta-1 domain forms hydrogen bonds with CDR2 and CDR3 alpha-domains of TCR (PubMed:19303388).; DOMAIN: The beta-2 Ig-like domain mediates the interaction with CD4 coreceptor.
Domain (FT)
126..214; Ig-like C1-type
Region
30..124; Beta-1; 125..227; Beta-2
Clinical Relevance
Related Diseases
Biomarker
Approved
Drugs (45)
ASPIRINRILONACEPTINFLIXIMAB-DYYBADALIMUMAB-ADBMCARBIMAZOLELAMOTRIGINEFLOXACILLINTICLOPIDINEATORVASTATIN CALCIUM TRIHYDRATECANAKINUMABCLAVULANIC ACIDPRAVASTATIN SODIUMLYM-1MERCAPTOPURINEDAPSONEMEASLES VACCINENULLAMOXICILLIN ANHYDROUSOXCARBAZEPINEROSUVASTATINSIMVASTATINPLOVAMER ACETATECARBAMAZEPINEAPOLIZUMABINFLUENZA VACCINEABACAVIRMETHIMAZOLEAZATHIOPRINELUMIRACOXIBDABRAFENIBPITAVASTATINBUCILLAMINEHYDRALAZINEEFAVIRENZPROPYLTHIOURACILFLUPIRTINELAPATINIBETANERCEPT-SZZSFLUVASTATINGLATIRAMERASPARAGINASETOCILIZUMABANAKINRAPEGASPARGASEINTERFERON BETA-1A
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |